Protein Family IF09485
Metagenome
Isolate
133
Members
26
Samples
130
Scaffolds
261.03
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_360876|Ga0466704_360876_2090_3010
- Length
- 306 aa
- Sequence
- MGVVLRVINIFIEEFALTLRVNVRLKQAAMPPLFIGAKMKVLEKVLGAALVVLLAGAVLTGCGNARGERDVAAIKKAGVLKVGVKADVPGFGLQNTATGQYEGFEIELAKLIANEILGDSSKVAFTAVTAKTRGPLIDTGELDMIIATFTITDERKLTYNFTTPYYTDAVGMLVKKSAGISGLVDLDGKTIGVAQSATSKVAIEAAAFALKGADAGVSPKFAEFATYPEIKAALDSGRVDVFSVDKSILSGYLDDETVILPDAFSPQPYGVTTKLQNKALAAYLDGLIAKWLADGTIDRLIRQFNL
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
53.8%
Unclassified
23.1%
Termopsidae
11.5%
Rhinotermitidae
7.7%
Hodotermitidae
3.8%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 4 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 5 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 6 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 7 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 8 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 9 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 10 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_083855 | 3300042616 | Bacteria | 7906 |
| 2 | Ga0466715_185518 | 3300042616 | Bacteria | 2340 |
| 3 | Ga0466723_017120 | 3300042618 | Bacteria | 3604 |
| 4 | Ga0466713_107989 | 3300042602 | Bacteria | 4352 |
| 5 | Ga0466735_089234 | 3300042624 | Bacteria | 1197 |
| 6 | Ga0466735_197814 | 3300042624 | Bacteria | 1474 |
| 7 | Ga0466703_010353 | 3300042636 | Bacteria | 2130 |
| 8 | Ga0466704_054263 | 3300042643 | Bacteria | 2806 |
| 9 | Ga0466704_457287 | 3300042643 | Bacteria | 2457 |
| 10 | Ga0466708_200362 | 3300042652 | Bacteria | 1078 |
| 11 | Ga0466708_237207 | 3300042652 | Bacteria | 2980 |
| 12 | Ga0466711_037919 | 3300042615 | Bacteria | 11222 |
| 13 | Ga0466711_289531 | 3300042615 | Bacteria | 2211 |
| 14 | Ga0466715_091290 | 3300042616 | Bacteria | 11267 |
| 15 | Ga0466723_062858 | 3300042618 | Bacteria | 2168 |
| 16 | Ga0466726_033508 | 3300042619 | Bacteria | 4685 |
| 17 | Ga0466726_111867 | 3300042619 | Bacteria | 10173 |
| 18 | Ga0466728_474170 | 3300042620 | Bacteria | 13531 |
| 19 | Ga0466706_258706 | 3300042599 | Bacteria | 2373 |
| 20 | Ga0466735_176096 | 3300042624 | Bacteria | 2962 |
| 21 | Ga0466703_154500 | 3300042636 | Bacteria | 1460 |
| 22 | Ga0466703_167297 | 3300042636 | Bacteria | 2964 |
| 23 | Ga0466704_072517 | 3300042643 | Bacteria | 21926 |
| 24 | Ga0466704_306656 | 3300042643 | Bacteria | 5407 |
| 25 | Ga0466709_395702 | 3300042648 | Bacteria | 13156 |
| 26 | Ga0466708_063763 | 3300042652 | Bacteria | 12357 |
| 27 | Ga0466708_307727 | 3300042652 | Bacteria | 2015 |
| 28 | Ga0466727_066233 | 3300042655 | Bacteria | 4372 |
| 29 | Ga0068305_10037418 | 3300005083 | Bacteria | 10822 |
| 30 | Ga0466690_301582 | 3300042590 | Bacteria | 1252 |
| 31 | Ga0466696_186899 | 3300042596 | Bacteria | 28959 |
| 32 | Ga0466713_128169 | 3300042602 | Bacteria | 1187 |
| 33 | Ga0466716_083539 | 3300042605 | Bacteria | 5939 |
| 34 | Ga0466719_338575 | 3300042606 | Bacteria | 2360 |
| 35 | Ga0466703_207799 | 3300042636 | Bacteria | 3451 |
| 36 | Ga0466690_004435 | 3300042590 | Bacteria | 6624 |
| 37 | Ga0466691_073674 | 3300042593 | Bacteria | 19800 |
| 38 | Ga0466696_102263 | 3300042596 | Bacteria | 3997 |
| 39 | Ga0466705_207013 | 3300042612 | Bacteria | 7944 |
| 40 | Ga0466705_277691 | 3300042612 | Bacteria | 1585 |
| 41 | Ga0466705_386636 | 3300042612 | Bacteria | 9511 |
| 42 | Ga0466705_396396 | 3300042612 | Bacteria | 4202 |
| 43 | Ga0466715_129347 | 3300042616 | Bacteria | 25762 |
| 44 | Ga0466715_393493 | 3300042616 | Bacteria | 42943 |
| 45 | Ga0466726_041554 | 3300042619 | Bacteria | 19362 |
| 46 | Ga0466726_450156 | 3300042619 | Bacteria | 3111 |
| 47 | Ga0466728_307196 | 3300042620 | Bacteria | 6807 |
| 48 | Ga0466728_428210 | 3300042620 | Bacteria | 3960 |
| 49 | Ga0466729_143029 | 3300042621 | Bacteria | 3554 |
| 50 | Ga0466707_019103 | 3300042601 | Bacteria | 1463 |
| 51 | Ga0466716_309743 | 3300042605 | Bacteria | 3798 |
| 52 | Ga0466719_253864 | 3300042606 | Bacteria | 21999 |
| 53 | Ga0466719_260597 | 3300042606 | Bacteria | 6316 |
| 54 | Ga0466703_082209 | 3300042636 | Bacteria | 13415 |
| 55 | Ga0466703_189991 | 3300042636 | Bacteria | 8633 |
| 56 | Ga0466709_162669 | 3300042648 | Bacteria | 2387 |
| 57 | Ga0466708_075720 | 3300042652 | Unclassified | 1707 |
| 58 | Ga0466708_253289 | 3300042652 | Bacteria | 12228 |
| 59 | Ga0466708_297598 | 3300042652 | Bacteria | 17085 |
| 60 | Ga0466727_039855 | 3300042655 | Bacteria | 2648 |
| 61 | Ga0466691_215279 | 3300042593 | Bacteria | 2988 |
| 62 | Ga0466696_100178 | 3300042596 | Bacteria | 6527 |
| 63 | Ga0466705_287017 | 3300042612 | Bacteria | 2344 |
| 64 | Ga0466705_289413 | 3300042612 | Unclassified | 3508 |
| 65 | Ga0466705_427773 | 3300042612 | Bacteria | 83042 |
| 66 | Ga0466715_407195 | 3300042616 | Bacteria | 3955 |
| 67 | Ga0466726_081025 | 3300042619 | Bacteria | 1705 |
| 68 | Ga0466719_251258 | 3300042606 | Bacteria | 5018 |
| 69 | Ga0466722_084034 | 3300042609 | Bacteria | 7429 |
| 70 | Ga0466735_183312 | 3300042624 | Bacteria | 1240 |
| 71 | Ga0466735_229248 | 3300042624 | Bacteria | 1098 |
| 72 | Ga0466703_092023 | 3300042636 | Bacteria | 6584 |
| 73 | Ga0466709_196075 | 3300042648 | Bacteria | 1195 |
| 74 | Ga0466727_157570 | 3300042655 | Bacteria | 2205 |
| 75 | Ga0466727_174240 | 3300042655 | Bacteria | 40571 |
| 76 | Ga0068305_10107581 | 3300005083 | Bacteria | 4772 |
| 77 | Ga0466690_300320 | 3300042590 | Bacteria | 2177 |
| 78 | Ga0466691_085737 | 3300042593 | Bacteria | 3954 |
| 79 | Ga0466691_212116 | 3300042593 | Bacteria | 3423 |
| 80 | Ga0466705_038541 | 3300042612 | Bacteria | 17641 |
| 81 | Ga0466715_187758 | 3300042616 | Bacteria | 4757 |
| 82 | Ga0466715_433962 | 3300042616 | Bacteria | 11375 |
| 83 | Ga0466723_033959 | 3300042618 | Bacteria | 3099 |
| 84 | Ga0466728_018520 | 3300042620 | Bacteria | 1614 |
| 85 | Ga0466707_036542 | 3300042601 | Bacteria | 3435 |
| 86 | Ga0466707_377637 | 3300042601 | Bacteria | 2454 |
| 87 | Ga0466719_187181 | 3300042606 | Bacteria | 5233 |
| 88 | Ga0466735_034187 | 3300042624 | Bacteria | 1556 |
| 89 | Ga0466735_153812 | 3300042624 | Bacteria | 1863 |
| 90 | Ga0466703_339649 | 3300042636 | Bacteria | 7039 |
| 91 | Ga0466704_069308 | 3300042643 | Bacteria | 4165 |
| 92 | Ga0466704_072691 | 3300042643 | Bacteria | 3009 |
| 93 | Ga0466704_177108 | 3300042643 | Bacteria | 1553 |
| 94 | Ga0466708_120491 | 3300042652 | Bacteria | 2378 |
| 95 | Ga0466708_264194 | 3300042652 | Bacteria | 2651 |
| 96 | Ga0466690_041438 | 3300042590 | Bacteria | 3151 |
| 97 | Ga0466691_014558 | 3300042593 | Bacteria | 7753 |
| 98 | Ga0466711_123336 | 3300042615 | Bacteria | 2155 |
| 99 | Ga0466711_140978 | 3300042615 | Bacteria | 11630 |
| 100 | Ga0466711_266253 | 3300042615 | Bacteria | 5360 |
| 101 | Ga0466706_239303 | 3300042599 | Bacteria | 4953 |
| 102 | Ga0466716_467705 | 3300042605 | Bacteria | 8879 |
| 103 | Ga0466716_516729 | 3300042605 | Bacteria | 4490 |
| 104 | Ga0466719_014295 | 3300042606 | Bacteria | 5280 |
| 105 | Ga0466719_484205 | 3300042606 | Bacteria | 1675 |
| 106 | Ga0466735_010372 | 3300042624 | Bacteria | 1743 |
| 107 | Ga0466704_105636 | 3300042643 | Bacteria | 29340 |
| 108 | Ga0466704_251893 | 3300042643 | Bacteria | 11440 |
| 109 | Ga0466704_360876 | 3300042643 | Bacteria | 5062 |
| 110 | Ga0466709_138552 | 3300042648 | Bacteria | 2014 |
| 111 | Ga0466708_054204 | 3300042652 | Bacteria | 1669 |
| 112 | Ga0466708_143925 | 3300042652 | Bacteria | 9438 |
| 113 | Ga0466727_066566 | 3300042655 | Bacteria | 2648 |
| 114 | Ga0466691_036648 | 3300042593 | Bacteria | 19285 |
| 115 | Ga0466696_035962 | 3300042596 | Bacteria | 9814 |
| 116 | Ga0466705_116683 | 3300042612 | Bacteria | 4489 |
| 117 | Ga0466705_358413 | 3300042612 | Bacteria | 8237 |
| 118 | Ga0466705_422755 | 3300042612 | Bacteria | 1557 |
| 119 | Ga0466711_253027 | 3300042615 | Bacteria | 1349 |
| 120 | Ga0466723_064442 | 3300042618 | Bacteria | 17565 |
| 121 | Ga0466726_006188 | 3300042619 | Bacteria | 1922 |
| 122 | Ga0466726_009424 | 3300042619 | Bacteria | 7336 |
| 123 | Ga0466726_344539 | 3300042619 | Bacteria | 1237 |
| 124 | Ga0466728_230945 | 3300042620 | Bacteria | 2537 |
| 125 | Ga0466719_541086 | 3300042606 | Bacteria | 2528 |
| 126 | Ga0466735_009580 | 3300042624 | Bacteria | 5652 |
| 127 | Ga0466735_091489 | 3300042624 | Bacteria | 1182 |
| 128 | Ga0466709_103451 | 3300042648 | Bacteria | 2557 |
| 129 | Ga0466709_308001 | 3300042648 | Bacteria | 15552 |
| 130 | Ga0466708_378052 | 3300042652 | Unclassified | 16245 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.