Protein Family IF09474
Metagenome
Isolate
134
Members
52
Samples
133
Scaffolds
228.38
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_343880|Ga0466704_343880_169_927
- Length
- 252 aa
- Sequence
- MYLPPPHYIENQPFISLVTGGSRGIGRAICIKLAEMGFSVLINYQSNKTAAEETKWLIEQNGGMAELLPFDVANSAEVDKALSEWQAAHADEYISVLVNNAGIRKDNLMFWMSDEEWNTVLNTNLNGTFYITRALVKYMMNKKFGRIINIVSISGVHGMAGQTNYSAAKAGIIGMTKSLALEAAKKCVTVNAVAPGFIETDMTKDLPQDELKKIIPANRFGKPEEVADLVGFLASEKSSYITGQVISISGGL
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.0%
Kalotermitidae
28.0%
Unclassified
8.0%
Rhinotermitidae
6.0%
Termopsidae
6.0%
Passalidae
4.0%
Drosophilidae
2.0%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 47 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_198975 | 3300042659 | Bacteria | 6190 |
| 2 | Ga0466711_016056 | 3300042615 | Bacteria | 3895 |
| 3 | Ga0466728_281160 | 3300042620 | Bacteria | 13069 |
| 4 | Ga0466713_043123 | 3300042602 | Bacteria | 81226 |
| 5 | Ga0466713_049669 | 3300042602 | Bacteria | 3414 |
| 6 | Ga0466690_015023 | 3300042590 | Bacteria | 27335 |
| 7 | Ga0466690_147695 | 3300042590 | Bacteria | 7532 |
| 8 | Ga0466690_409142 | 3300042590 | Bacteria | 5724 |
| 9 | JGI24696J40584_12922406 | 3300002834 | Bacteria | 1364 |
| 10 | JGI24696J40584_12959530 | 3300002834 | Bacteria | 5248 |
| 11 | Ga0068305_10014021 | 3300005083 | Bacteria | 5645 |
| 12 | Ga0466734_106425 | 3300042623 | Bacteria | 3433 |
| 13 | Ga0466735_136477 | 3300042624 | Bacteria | 4861 |
| 14 | Ga0466702_404218 | 3300042635 | Bacteria | 1530 |
| 15 | Ga0466704_553150 | 3300042643 | Bacteria | 16914 |
| 16 | Ga0466711_032059 | 3300042615 | Bacteria | 12290 |
| 17 | Ga0466728_046855 | 3300042620 | Bacteria | 21751 |
| 18 | Ga0466728_081740 | 3300042620 | Bacteria | 2021 |
| 19 | Ga0123354_10011041 | 3300010882 | Bacteria | 13936 |
| 20 | Ga0466701_071754 | 3300042598 | Bacteria | 32901 |
| 21 | Ga0466716_065279 | 3300042605 | Bacteria | 3048 |
| 22 | Ga0466716_202600 | 3300042605 | Bacteria | 25648 |
| 23 | Ga0466698_132970 | 3300042610 | Bacteria | 1073 |
| 24 | Ga0466695_390885 | 3300042595 | Bacteria | 18621 |
| 25 | 2227519642 | 2225789004 | Bacteria | 3367 |
| 26 | Ga0466705_130431 | 3300042612 | Bacteria | 14655 |
| 27 | Ga0466705_158758 | 3300042612 | Bacteria | 11045 |
| 28 | Ga0466730_050208 | 3300042625 | Bacteria | 1282 |
| 29 | Ga0466703_173446 | 3300042636 | Bacteria | 2179 |
| 30 | Ga0466709_315607 | 3300042648 | Bacteria | 6478 |
| 31 | Ga0466708_323336 | 3300042652 | Bacteria | 4686 |
| 32 | Ga0466708_347084 | 3300042652 | Bacteria | 11166 |
| 33 | Ga0466715_457116 | 3300042616 | Bacteria | 1362 |
| 34 | Ga0466726_101328 | 3300042619 | Bacteria | 1648 |
| 35 | Ga0466728_138171 | 3300042620 | Bacteria | 48750 |
| 36 | Ga0466707_142159 | 3300042601 | Bacteria | 15563 |
| 37 | Ga0466719_064486 | 3300042606 | Bacteria | 19424 |
| 38 | Ga0466692_010939 | 3300042591 | Bacteria | 6058 |
| 39 | Ga0466699_429631 | 3300042597 | Bacteria | 1032 |
| 40 | 2227502413 | 2225789004 | Bacteria | 19081 |
| 41 | IMNBL1DRAFT_c0012449 | 3300000062 | Bacteria | 3886 |
| 42 | JGI24705J35276_12227880 | 3300002504 | Bacteria | 3082 |
| 43 | Ga0466697_246081 | 3300042611 | Bacteria | 2248 |
| 44 | Ga0466735_064108 | 3300042624 | Bacteria | 1200 |
| 45 | Ga0466704_343880 | 3300042643 | Bacteria | 4222 |
| 46 | Ga0466704_565068 | 3300042643 | Bacteria | 14460 |
| 47 | Ga0466709_118280 | 3300042648 | Bacteria | 8998 |
| 48 | Ga0466727_136604 | 3300042655 | Bacteria | 8202 |
| 49 | Ga0466715_042899 | 3300042616 | Bacteria | 3619 |
| 50 | Ga0466726_083706 | 3300042619 | Bacteria | 2406 |
| 51 | Ga0123357_10354238 | 3300009784 | Bacteria | 1399 |
| 52 | Ga0123356_10083711 | 3300010049 | Bacteria | 3022 |
| 53 | Ga0466700_400953 | 3300042600 | Bacteria | 5896 |
| 54 | Ga0466707_300694 | 3300042601 | Bacteria | 1422 |
| 55 | Ga0466713_137191 | 3300042602 | Bacteria | 44160 |
| 56 | Ga0466722_147392 | 3300042609 | Bacteria | 7169 |
| 57 | Ga0466696_196436 | 3300042596 | Bacteria | 12458 |
| 58 | Ga0466696_244762 | 3300042596 | Unclassified | 1202 |
| 59 | Ga0466696_251909 | 3300042596 | Bacteria | 7596 |
| 60 | Ga0466696_396279 | 3300042596 | Bacteria | 8634 |
| 61 | Ga0072941_1059712 | 3300005201 | Bacteria | 1036 |
| 62 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 63 | Ga0466704_094724 | 3300042643 | Bacteria | 10795 |
| 64 | Ga0466727_005019 | 3300042655 | Bacteria | 2887 |
| 65 | Ga0466733_081841 | 3300042659 | Bacteria | 24699 |
| 66 | Ga0466723_025842 | 3300042618 | Bacteria | 14881 |
| 67 | Ga0466723_233898 | 3300042618 | Bacteria | 28559 |
| 68 | Ga0466723_287832 | 3300042618 | Bacteria | 14308 |
| 69 | Ga0123354_10055289 | 3300010882 | Bacteria | 5943 |
| 70 | Ga0123354_10158704 | 3300010882 | Bacteria | 2698 |
| 71 | Ga0466713_033344 | 3300042602 | Bacteria | 37079 |
| 72 | Ga0264413_153689 | 3300024493 | Bacteria | 1981 |
| 73 | Ga0466693_424981 | 3300042592 | Bacteria | 1005 |
| 74 | Ga0466694_384298 | 3300042594 | Bacteria | 1695 |
| 75 | Ga0466696_065653 | 3300042596 | Bacteria | 4646 |
| 76 | Ga0466701_015312 | 3300042598 | Bacteria | 9824 |
| 77 | 2227574617 | 2225789004 | Bacteria | 13767 |
| 78 | JGI24702J35022_10013285 | 3300002462 | Bacteria | 4562 |
| 79 | Ga0466727_280418 | 3300042655 | Bacteria | 10325 |
| 80 | Ga0466733_005525 | 3300042659 | Bacteria | 4426 |
| 81 | Ga0466712_259532 | 3300042614 | Bacteria | 6230 |
| 82 | Ga0466711_032444 | 3300042615 | Bacteria | 3796 |
| 83 | Ga0466723_271659 | 3300042618 | Bacteria | 24829 |
| 84 | Ga0466726_121930 | 3300042619 | Bacteria | 1451 |
| 85 | Ga0466726_458480 | 3300042619 | Bacteria | 4048 |
| 86 | Ga0466728_010149 | 3300042620 | Bacteria | 2570 |
| 87 | Ga0466713_037432 | 3300042602 | Bacteria | 6142 |
| 88 | Ga0466714_102785 | 3300042603 | Bacteria | 2189 |
| 89 | Ga0466717_225841 | 3300042604 | Bacteria | 2220 |
| 90 | Ga0466716_355646 | 3300042605 | Bacteria | 19620 |
| 91 | Ga0466719_018684 | 3300042606 | Bacteria | 3047 |
| 92 | Ga0466698_039560 | 3300042610 | Bacteria | 7969 |
| 93 | Ga0466690_319186 | 3300042590 | Bacteria | 19732 |
| 94 | Ga0466693_402129 | 3300042592 | Bacteria | 3401 |
| 95 | JGI24702J35022_10063479 | 3300002462 | Bacteria | 1979 |
| 96 | Ga0466729_252478 | 3300042621 | Bacteria | 2464 |
| 97 | Ga0466735_108902 | 3300042624 | Bacteria | 1381 |
| 98 | Ga0466735_158460 | 3300042624 | Bacteria | 7315 |
| 99 | Ga0466703_173935 | 3300042636 | Bacteria | 16868 |
| 100 | Ga0466709_279583 | 3300042648 | Bacteria | 6500 |
| 101 | Ga0466715_192999 | 3300042616 | Bacteria | 22224 |
| 102 | Ga0466715_198412 | 3300042616 | Bacteria | 6443 |
| 103 | Ga0466707_140740 | 3300042601 | Bacteria | 10682 |
| 104 | Ga0466707_192130 | 3300042601 | Bacteria | 24568 |
| 105 | Ga0466707_311602 | 3300042601 | Bacteria | 7197 |
| 106 | Ga0466722_103769 | 3300042609 | Bacteria | 5072 |
| 107 | Ga0466697_032142 | 3300042611 | Bacteria | 3784 |
| 108 | Ga0466657_105158 | 3300042582 | Bacteria | 4192 |
| 109 | Ga0466690_169000 | 3300042590 | Bacteria | 4170 |
| 110 | Ga0466691_007316 | 3300042593 | Bacteria | 2143 |
| 111 | Ga0466691_058246 | 3300042593 | Bacteria | 14754 |
| 112 | Ga0466699_213100 | 3300042597 | Bacteria | 2438 |
| 113 | Ga0466701_005323 | 3300042598 | Bacteria | 1540 |
| 114 | IMNBL1DRAFT_c0036237 | 3300000062 | Bacteria | 1725 |
| 115 | Ga0105553_1012618 | 3300007767 | Bacteria | 1889 |
| 116 | Ga0466697_192850 | 3300042611 | Bacteria | 17708 |
| 117 | Ga0466705_287293 | 3300042612 | Bacteria | 14401 |
| 118 | Ga0466704_455705 | 3300042643 | Bacteria | 20389 |
| 119 | Ga0466710_309523 | 3300042613 | Bacteria | 2306 |
| 120 | Ga0466715_404214 | 3300042616 | Bacteria | 35013 |
| 121 | Ga0466701_021112 | 3300042598 | Unclassified | 23354 |
| 122 | Ga0466707_327113 | 3300042601 | Bacteria | 3225 |
| 123 | Ga0466707_352499 | 3300042601 | Bacteria | 5876 |
| 124 | Ga0466722_059383 | 3300042609 | Bacteria | 11770 |
| 125 | Ga0466692_202069 | 3300042591 | Bacteria | 2364 |
| 126 | Ga0466696_024005 | 3300042596 | Bacteria | 8939 |
| 127 | JGI24702J35022_10002422 | 3300002462 | Bacteria | 11391 |
| 128 | JGI24702J35022_10013784 | 3300002462 | Bacteria | 4469 |
| 129 | JGI24702J35022_10020359 | 3300002462 | Bacteria | 3602 |
| 130 | JGI24696J40584_12959255 | 3300002834 | Bacteria | 4886 |
| 131 | Ga0466705_324546 | 3300042612 | Bacteria | 16838 |
| 132 | Ga0466704_348858 | 3300042643 | Bacteria | 25783 |
| 133 | Ga0466727_054700 | 3300042655 | Bacteria | 4503 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.