Protein Family IF09426
Metagenome
Isolate
164
Members
40
Samples
160
Scaffolds
242.18
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_218273|Ga0466704_218273_10724_11536
- Length
- 270 aa
- Sequence
- MKLLLVLGSDETSSLVSSYAEPLGFNLIRYRYVPKAMDNLEEIDPAGIIISARDFPRHWKVMVQYVRSSRPKEICPIILLKDDHFPLEETSKAFFLGVSGIVSEALEERTELDRLQGILSRYIPLDEKRKAQRHYAENWNRFGFLFSNPKDMTIISGEVKTISSSGLSFAPLNPDMLKNIRLNMELRECSLRAGSAILSPVCVLTRTGLVISLRFESFPENEQGILDKYLEGLPFLKLKNTLEEEKKKTEEKAFGLAEHDERAEELSPLD
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Termitidae
34.2%
Unclassified
13.2%
Rhinotermitidae
7.9%
Termopsidae
7.9%
Taxonomy
Archaea
1
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10700683 | 3300010167 | Bacteria | 1421 |
| 2 | Ga0264413_144380 | 3300024493 | Bacteria | 1557 |
| 3 | Ga0456237_0007676 | 3300041968 | Bacteria | 1654 |
| 4 | Ga0466691_003086 | 3300042593 | Bacteria | 3498 |
| 5 | Ga0466699_151898 | 3300042597 | Bacteria | 4895 |
| 6 | Ga0466716_095086 | 3300042605 | Bacteria | 1464 |
| 7 | Ga0466716_095612 | 3300042605 | Bacteria | 1283 |
| 8 | Ga0466716_374332 | 3300042605 | Bacteria | 3862 |
| 9 | Ga0466719_039887 | 3300042606 | Bacteria | 1218 |
| 10 | Ga0466720_001847 | 3300042607 | Bacteria | 14739 |
| 11 | Ga0466722_201439 | 3300042609 | Bacteria | 1139 |
| 12 | Ga0466705_183488 | 3300042612 | Bacteria | 2845 |
| 13 | Ga0466712_192498 | 3300042614 | Bacteria | 2637 |
| 14 | Ga0466712_218160 | 3300042614 | Bacteria | 1796 |
| 15 | Ga0466711_034799 | 3300042615 | Bacteria | 18162 |
| 16 | Ga0466715_578998 | 3300042616 | Bacteria | 24023 |
| 17 | Ga0466715_617902 | 3300042616 | Bacteria | 1076 |
| 18 | Ga0466723_008861 | 3300042618 | Bacteria | 2447 |
| 19 | Ga0466723_290689 | 3300042618 | Bacteria | 1479 |
| 20 | Ga0466726_042769 | 3300042619 | Bacteria | 28047 |
| 21 | Ga0466728_181523 | 3300042620 | Bacteria | 1856 |
| 22 | Ga0466728_472700 | 3300042620 | Bacteria | 7189 |
| 23 | Ga0466735_201612 | 3300042624 | Bacteria | 2103 |
| 24 | Ga0466703_020216 | 3300042636 | Bacteria | 9558 |
| 25 | Ga0466704_100975 | 3300042643 | Bacteria | 8177 |
| 26 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 27 | Ga0466708_102740 | 3300042652 | Bacteria | 2295 |
| 28 | Ga0466727_327507 | 3300042655 | Bacteria | 2730 |
| 29 | JGI24698J34947_10055616 | 3300002449 | Unclassified | 1970 |
| 30 | JGI24698J34947_10058357 | 3300002449 | Bacteria | 1912 |
| 31 | JGI24702J35022_10001839 | 3300002462 | Bacteria | 13071 |
| 32 | Ga0123353_11438662 | 3300010167 | Bacteria | 883 |
| 33 | Ga0466692_194237 | 3300042591 | Bacteria | 2335 |
| 34 | Ga0466691_013250 | 3300042593 | Bacteria | 1695 |
| 35 | Ga0466694_201000 | 3300042594 | Bacteria | 1237 |
| 36 | Ga0466722_000578 | 3300042609 | Bacteria | 7207 |
| 37 | Ga0466705_153285 | 3300042612 | Bacteria | 11777 |
| 38 | Ga0466705_204736 | 3300042612 | Bacteria | 18205 |
| 39 | Ga0466715_551351 | 3300042616 | Bacteria | 2451 |
| 40 | Ga0466723_340980 | 3300042618 | Bacteria | 3505 |
| 41 | Ga0466708_003759 | 3300042652 | Bacteria | 1053 |
| 42 | Ga0466708_020351 | 3300042652 | Bacteria | 35169 |
| 43 | AustNasuHG_c1015036 | 3300000089 | Bacteria | 2619 |
| 44 | JGI24698J34947_10011756 | 3300002449 | Bacteria | 4806 |
| 45 | JGI24698J34947_10084790 | 3300002449 | Bacteria | 1474 |
| 46 | JGI24698J34947_10092234 | 3300002449 | Bacteria | 1386 |
| 47 | Ga0123356_10230010 | 3300010049 | Bacteria | 1918 |
| 48 | Ga0466690_249769 | 3300042590 | Bacteria | 1836 |
| 49 | Ga0466690_315726 | 3300042590 | Unclassified | 1260 |
| 50 | Ga0466690_353936 | 3300042590 | Bacteria | 1551 |
| 51 | Ga0466691_089239 | 3300042593 | Bacteria | 12278 |
| 52 | Ga0466691_101256 | 3300042593 | Bacteria | 1691 |
| 53 | Ga0466691_194184 | 3300042593 | Bacteria | 15293 |
| 54 | Ga0466694_012820 | 3300042594 | Bacteria | 1194 |
| 55 | Ga0466707_061761 | 3300042601 | Bacteria | 2775 |
| 56 | Ga0466719_470517 | 3300042606 | Bacteria | 3128 |
| 57 | Ga0466718_035678 | 3300042617 | Bacteria | 14749 |
| 58 | Ga0466723_180663 | 3300042618 | Bacteria | 2047 |
| 59 | Ga0466723_324585 | 3300042618 | Unclassified | 12873 |
| 60 | Ga0466723_325742 | 3300042618 | Bacteria | 4140 |
| 61 | Ga0466703_091197 | 3300042636 | Bacteria | 25667 |
| 62 | JGI24698J34947_10041051 | 3300002449 | Bacteria | 2385 |
| 63 | JGI24698J34947_10133815 | 3300002449 | Bacteria | 1055 |
| 64 | JGI24695J34938_10000542 | 3300002450 | Bacteria | 36534 |
| 65 | JGI24695J34938_10078761 | 3300002450 | Bacteria | 1364 |
| 66 | JGI24702J35022_10056629 | 3300002462 | Bacteria | 2092 |
| 67 | Ga0466691_129261 | 3300042593 | Bacteria | 1149 |
| 68 | Ga0466696_324431 | 3300042596 | Bacteria | 1443 |
| 69 | Ga0466696_435701 | 3300042596 | Bacteria | 8824 |
| 70 | Ga0466699_108387 | 3300042597 | Bacteria | 9555 |
| 71 | Ga0466698_114127 | 3300042610 | Bacteria | 1463 |
| 72 | Ga0466705_013726 | 3300042612 | Bacteria | 31494 |
| 73 | Ga0466705_131799 | 3300042612 | Bacteria | 3271 |
| 74 | Ga0466712_110973 | 3300042614 | Bacteria | 7456 |
| 75 | Ga0466712_312622 | 3300042614 | Bacteria | 3323 |
| 76 | Ga0466711_011556 | 3300042615 | Bacteria | 5493 |
| 77 | Ga0466715_160435 | 3300042616 | Bacteria | 9799 |
| 78 | Ga0466715_207366 | 3300042616 | Bacteria | 1443 |
| 79 | Ga0466735_151264 | 3300042624 | Bacteria | 3853 |
| 80 | Ga0466703_157107 | 3300042636 | Bacteria | 14256 |
| 81 | Ga0466703_212476 | 3300042636 | Bacteria | 1384 |
| 82 | Ga0466703_306142 | 3300042636 | Bacteria | 6822 |
| 83 | Ga0466708_040913 | 3300042652 | Bacteria | 8879 |
| 84 | JGI24698J34947_10008345 | 3300002449 | Bacteria | 5683 |
| 85 | JGI24695J34938_10014535 | 3300002450 | Archaea | 4077 |
| 86 | Ga0072941_1115775 | 3300005201 | Bacteria | 3688 |
| 87 | Ga0466690_217407 | 3300042590 | Bacteria | 1246 |
| 88 | Ga0466699_151707 | 3300042597 | Bacteria | 5008 |
| 89 | Ga0466716_352671 | 3300042605 | Bacteria | 6365 |
| 90 | Ga0466716_485148 | 3300042605 | Bacteria | 2822 |
| 91 | Ga0466719_079168 | 3300042606 | Bacteria | 1552 |
| 92 | Ga0466712_073940 | 3300042614 | Bacteria | 1639 |
| 93 | Ga0466711_247962 | 3300042615 | Bacteria | 3365 |
| 94 | Ga0466715_480821 | 3300042616 | Bacteria | 1039 |
| 95 | Ga0466723_218601 | 3300042618 | Bacteria | 1048 |
| 96 | Ga0466728_126782 | 3300042620 | Bacteria | 3567 |
| 97 | Ga0466703_009073 | 3300042636 | Unclassified | 3285 |
| 98 | Ga0466704_140988 | 3300042643 | Bacteria | 10220 |
| 99 | Ga0466709_172904 | 3300042648 | Bacteria | 14335 |
| 100 | Ga0466727_243860 | 3300042655 | Bacteria | 15153 |
| 101 | JGI24698J34947_10008566 | 3300002449 | Bacteria | 5614 |
| 102 | JGI24698J34947_10146376 | 3300002449 | Bacteria | 987 |
| 103 | JGI24695J34938_10118804 | 3300002450 | Bacteria | 1076 |
| 104 | Ga0072940_1161882 | 3300005200 | Bacteria | 1157 |
| 105 | Ga0466690_380375 | 3300042590 | Bacteria | 1606 |
| 106 | Ga0466699_040916 | 3300042597 | Bacteria | 6428 |
| 107 | Ga0466722_000511 | 3300042609 | Bacteria | 9118 |
| 108 | Ga0466722_107027 | 3300042609 | Bacteria | 2796 |
| 109 | Ga0466722_197656 | 3300042609 | Bacteria | 3202 |
| 110 | Ga0466705_068195 | 3300042612 | Bacteria | 4062 |
| 111 | Ga0466712_079188 | 3300042614 | Unclassified | 3846 |
| 112 | Ga0466703_234873 | 3300042636 | Bacteria | 2239 |
| 113 | Ga0466703_325863 | 3300042636 | Bacteria | 8217 |
| 114 | Ga0466704_137190 | 3300042643 | Bacteria | 3796 |
| 115 | Ga0466704_333824 | 3300042643 | Bacteria | 21099 |
| 116 | Ga0466709_247826 | 3300042648 | Bacteria | 7622 |
| 117 | JGI24698J34947_10087039 | 3300002449 | Bacteria | 1446 |
| 118 | JGI24695J34938_10002900 | 3300002450 | Bacteria | 12463 |
| 119 | Ga0072941_1054757 | 3300005201 | Bacteria | 5088 |
| 120 | Ga0072941_1276854 | 3300005201 | Bacteria | 993 |
| 121 | Ga0466690_068104 | 3300042590 | Bacteria | 7646 |
| 122 | Ga0466699_233371 | 3300042597 | Bacteria | 3549 |
| 123 | Ga0466707_090889 | 3300042601 | Bacteria | 3137 |
| 124 | Ga0466707_174657 | 3300042601 | Bacteria | 1802 |
| 125 | Ga0466716_331501 | 3300042605 | Bacteria | 9506 |
| 126 | Ga0466722_181926 | 3300042609 | Bacteria | 13941 |
| 127 | Ga0466705_061946 | 3300042612 | Bacteria | 1329 |
| 128 | Ga0466712_024144 | 3300042614 | Bacteria | 2473 |
| 129 | Ga0466712_074938 | 3300042614 | Bacteria | 1805 |
| 130 | Ga0466712_097402 | 3300042614 | Bacteria | 1291 |
| 131 | Ga0466715_395557 | 3300042616 | Unclassified | 6814 |
| 132 | Ga0466715_424506 | 3300042616 | Bacteria | 10192 |
| 133 | Ga0466715_427689 | 3300042616 | Bacteria | 1482 |
| 134 | Ga0466723_052961 | 3300042618 | Bacteria | 34600 |
| 135 | Ga0466726_183165 | 3300042619 | Bacteria | 1788 |
| 136 | Ga0466728_071849 | 3300042620 | Bacteria | 3509 |
| 137 | Ga0466735_055995 | 3300042624 | Bacteria | 5280 |
| 138 | Ga0466709_067458 | 3300042648 | Bacteria | 2439 |
| 139 | JGI24698J34947_10014171 | 3300002449 | Bacteria | 4341 |
| 140 | JGI24698J34947_10029122 | 3300002449 | Bacteria | 2920 |
| 141 | JGI24698J34947_10030467 | 3300002449 | Bacteria | 2844 |
| 142 | JGI24695J34938_10045812 | 3300002450 | Bacteria | 1938 |
| 143 | JGI24695J34938_10078975 | 3300002450 | Bacteria | 1362 |
| 144 | JGI24702J35022_10008042 | 3300002462 | Bacteria | 6004 |
| 145 | Ga0072940_1042237 | 3300005200 | Bacteria | 7994 |
| 146 | Ga0466691_106366 | 3300042593 | Bacteria | 1186 |
| 147 | Ga0466699_008331 | 3300042597 | Bacteria | 2146 |
| 148 | Ga0466699_130536 | 3300042597 | Bacteria | 13039 |
| 149 | Ga0466719_100250 | 3300042606 | Bacteria | 17752 |
| 150 | Ga0466720_190326 | 3300042607 | Bacteria | 21257 |
| 151 | Ga0466712_137388 | 3300042614 | Bacteria | 1288 |
| 152 | Ga0466712_141668 | 3300042614 | Bacteria | 1658 |
| 153 | Ga0466715_392548 | 3300042616 | Bacteria | 2220 |
| 154 | Ga0466718_078599 | 3300042617 | Bacteria | 26285 |
| 155 | Ga0466704_218273 | 3300042643 | Bacteria | 27455 |
| 156 | Ga0466704_548479 | 3300042643 | Bacteria | 4708 |
| 157 | Ga0466709_036911 | 3300042648 | Bacteria | 6422 |
| 158 | Ga0466708_198988 | 3300042652 | Bacteria | 7953 |
| 159 | JGI24695J34938_10014192 | 3300002450 | Bacteria | 4143 |
| 160 | JGI24695J34938_10032847 | 3300002450 | Bacteria | 2393 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.