Protein Family IF09419
Metagenome
Isolate
203
Members
60
Samples
193
Scaffolds
252.82
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_202245|Ga0466704_202245_14987_15835
- Length
- 282 aa
- Sequence
- VNYKPNQARPALAPAGRTRVPPNPGQAVNVVRIPQIIRTEKLSKAFGANAVLKEVTLGIPEKKVSAVIGQSGTGKSVLFKTIMGMMKPDQGRVWFRDIELTAIKRSELIAMRRHFGYSFQNAALFDSMTVGENLAFPLREVLRIKDRGKIRRSVAEMLEWIELPGIESKRPDELSGGMRKRVGVARALIMQPEVLFFDEPTTGLDPVLSETINNLVVRVNRELHITCVMITHDIPAAFRIADKIAFLDQGYIIAEGSPREVVSSKHTMVRDFLRISFNELKV
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Kalotermitidae
25.9%
Unclassified
17.2%
Termopsidae
6.9%
Rhinotermitidae
5.2%
Blaberidae
1.7%
Taxonomy
Archaea
1
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 5 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 50 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 51 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 52 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 57 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 58 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 59 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_223816 | 3300042612 | Bacteria | 2543 |
| 2 | Ga0466705_257279 | 3300042612 | Bacteria | 4517 |
| 3 | Ga0466705_369611 | 3300042612 | Bacteria | 5074 |
| 4 | Ga0466700_295982 | 3300042600 | Bacteria | 1358 |
| 5 | Ga0466707_213830 | 3300042601 | Bacteria | 8802 |
| 6 | Ga0466719_035255 | 3300042606 | Unclassified | 1493 |
| 7 | Ga0466719_479880 | 3300042606 | Bacteria | 1837 |
| 8 | Ga0466697_045139 | 3300042611 | Bacteria | 12760 |
| 9 | Ga0466703_143749 | 3300042636 | Bacteria | 3999 |
| 10 | Ga0466703_188679 | 3300042636 | Bacteria | 4037 |
| 11 | Ga0466703_239168 | 3300042636 | Bacteria | 18053 |
| 12 | Ga0466709_027018 | 3300042648 | Bacteria | 5707 |
| 13 | Ga0466708_304447 | 3300042652 | Bacteria | 6402 |
| 14 | Ga0466715_065180 | 3300042616 | Bacteria | 5080 |
| 15 | JGI24696J40584_12943262 | 3300002834 | Bacteria | 1768 |
| 16 | Ga0068302_10556082 | 3300005071 | Bacteria | 904 |
| 17 | Ga0466691_188503 | 3300042593 | Bacteria | 2430 |
| 18 | Ga0466696_144821 | 3300042596 | Bacteria | 24072 |
| 19 | Ga0466705_049651 | 3300042612 | Bacteria | 6787 |
| 20 | Ga0466705_102688 | 3300042612 | Bacteria | 17173 |
| 21 | Ga0466705_181525 | 3300042612 | Bacteria | 22609 |
| 22 | Ga0466732_336543 | 3300042656 | Bacteria | 4764 |
| 23 | Ga0466701_075709 | 3300042598 | Bacteria | 2163 |
| 24 | Ga0466713_045396 | 3300042602 | Bacteria | 1458 |
| 25 | Ga0466722_059803 | 3300042609 | Bacteria | 24916 |
| 26 | Ga0123355_10070048 | 3300009826 | Bacteria | 5634 |
| 27 | Ga0466731_380565 | 3300042622 | Bacteria | 2919 |
| 28 | Ga0466735_188562 | 3300042624 | Bacteria | 3711 |
| 29 | Ga0466703_360992 | 3300042636 | Bacteria | 10288 |
| 30 | Ga0466703_389215 | 3300042636 | Bacteria | 42403 |
| 31 | Ga0466704_247867 | 3300042643 | Bacteria | 8426 |
| 32 | Ga0466704_612927 | 3300042643 | Bacteria | 2733 |
| 33 | Ga0466709_053653 | 3300042648 | Bacteria | 1588 |
| 34 | Ga0466711_250812 | 3300042615 | Bacteria | 11619 |
| 35 | Ga0466715_010756 | 3300042616 | Bacteria | 11031 |
| 36 | Ga0466715_124780 | 3300042616 | Bacteria | 3761 |
| 37 | Ga0466715_128970 | 3300042616 | Bacteria | 7256 |
| 38 | Ga0466715_321429 | 3300042616 | Bacteria | 8691 |
| 39 | Ga0466728_207263 | 3300042620 | Bacteria | 13163 |
| 40 | AustNasuHG_c1005130 | 3300000089 | Bacteria | 4684 |
| 41 | JGI24702J35022_10009842 | 3300002462 | Bacteria | 5358 |
| 42 | Ga0466690_080350 | 3300042590 | Bacteria | 2055 |
| 43 | Ga0466694_178229 | 3300042594 | Bacteria | 4317 |
| 44 | Ga0466695_290770 | 3300042595 | Bacteria | 97007 |
| 45 | Ga0466705_027668 | 3300042612 | Unclassified | 1280 |
| 46 | Ga0466705_067513 | 3300042612 | Bacteria | 4785 |
| 47 | Ga0466705_301735 | 3300042612 | Bacteria | 4620 |
| 48 | Ga0466707_222392 | 3300042601 | Bacteria | 12258 |
| 49 | Ga0466716_020160 | 3300042605 | Bacteria | 2048 |
| 50 | Ga0466716_415469 | 3300042605 | Bacteria | 5321 |
| 51 | Ga0466719_070401 | 3300042606 | Bacteria | 7337 |
| 52 | Ga0466719_297120 | 3300042606 | Bacteria | 1142 |
| 53 | Ga0123356_10010005 | 3300010049 | Bacteria | 9333 |
| 54 | Ga0123354_10398762 | 3300010882 | Bacteria | 1167 |
| 55 | Ga0466731_156783 | 3300042622 | Bacteria | 1205 |
| 56 | Ga0466704_160094 | 3300042643 | Bacteria | 11396 |
| 57 | Ga0466709_124918 | 3300042648 | Bacteria | 1946 |
| 58 | Ga0466708_171467 | 3300042652 | Bacteria | 2552 |
| 59 | Ga0466708_283097 | 3300042652 | Bacteria | 4990 |
| 60 | Ga0466705_484739 | 3300042612 | Bacteria | 6747 |
| 61 | Ga0466711_300254 | 3300042615 | Bacteria | 7469 |
| 62 | Ga0466715_110720 | 3300042616 | Bacteria | 1749 |
| 63 | Ga0466692_158534 | 3300042591 | Bacteria | 8572 |
| 64 | Ga0466692_172451 | 3300042591 | Bacteria | 2037 |
| 65 | Ga0466693_223695 | 3300042592 | Bacteria | 1057 |
| 66 | Ga0466695_063257 | 3300042595 | Bacteria | 1560 |
| 67 | Ga0466696_053241 | 3300042596 | Bacteria | 7332 |
| 68 | Ga0466699_053303 | 3300042597 | Bacteria | 6618 |
| 69 | Ga0466717_077938 | 3300042604 | Bacteria | 1547 |
| 70 | Ga0466716_028709 | 3300042605 | Bacteria | 1253 |
| 71 | Ga0466716_186547 | 3300042605 | Bacteria | 1257 |
| 72 | Ga0123356_10003416 | 3300010049 | Bacteria | 16639 |
| 73 | Ga0466704_140302 | 3300042643 | Bacteria | 3256 |
| 74 | Ga0466709_193696 | 3300042648 | Bacteria | 3024 |
| 75 | Ga0466708_285050 | 3300042652 | Bacteria | 48734 |
| 76 | Ga0466708_419574 | 3300042652 | Bacteria | 2156 |
| 77 | Ga0466727_290440 | 3300042655 | Bacteria | 1259 |
| 78 | Ga0466715_603655 | 3300042616 | Bacteria | 10375 |
| 79 | Ga0466718_076023 | 3300042617 | Bacteria | 19549 |
| 80 | Ga0466723_064254 | 3300042618 | Bacteria | 3007 |
| 81 | Ga0466723_196407 | 3300042618 | Bacteria | 1635 |
| 82 | Ga0466723_365336 | 3300042618 | Bacteria | 6225 |
| 83 | Ga0466728_231640 | 3300042620 | Bacteria | 9106 |
| 84 | Ga0466728_460005 | 3300042620 | Bacteria | 5101 |
| 85 | Ga0466728_479190 | 3300042620 | Bacteria | 5459 |
| 86 | JGI24698J34947_10040571 | 3300002449 | Bacteria | 2402 |
| 87 | JGI24695J34938_10018401 | 3300002450 | Bacteria | 3493 |
| 88 | Ga0415639_022751 | 3300038395 | Bacteria | 7862 |
| 89 | Ga0466657_101067 | 3300042582 | Bacteria | 1007 |
| 90 | Ga0466690_041598 | 3300042590 | Bacteria | 2052 |
| 91 | Ga0466691_036978 | 3300042593 | Bacteria | 4260 |
| 92 | Ga0466696_300246 | 3300042596 | Bacteria | 7689 |
| 93 | Ga0466732_214169 | 3300042656 | Bacteria | 2564 |
| 94 | Ga0466719_386768 | 3300042606 | Bacteria | 5527 |
| 95 | Ga0466719_428429 | 3300042606 | Bacteria | 8712 |
| 96 | Ga0466719_549108 | 3300042606 | Unclassified | 1631 |
| 97 | Ga0466703_082349 | 3300042636 | Bacteria | 4466 |
| 98 | Ga0466704_045761 | 3300042643 | Bacteria | 13519 |
| 99 | Ga0466704_237358 | 3300042643 | Bacteria | 7896 |
| 100 | Ga0466704_491861 | 3300042643 | Bacteria | 1002 |
| 101 | Ga0466709_140045 | 3300042648 | Bacteria | 12847 |
| 102 | Ga0466708_069200 | 3300042652 | Bacteria | 7285 |
| 103 | Ga0466708_111845 | 3300042652 | Bacteria | 5982 |
| 104 | Ga0466708_148083 | 3300042652 | Bacteria | 6634 |
| 105 | Ga0466711_037118 | 3300042615 | Bacteria | 3034 |
| 106 | Ga0466711_340444 | 3300042615 | Bacteria | 1591 |
| 107 | Ga0466715_266169 | 3300042616 | Bacteria | 1026 |
| 108 | Ga0466715_465901 | 3300042616 | Bacteria | 11392 |
| 109 | Ga0466715_517254 | 3300042616 | Bacteria | 19210 |
| 110 | Ga0466726_304465 | 3300042619 | Bacteria | 3622 |
| 111 | Ga0072941_1028231 | 3300005201 | Bacteria | 7379 |
| 112 | Ga0415639_117648 | 3300038395 | Bacteria | 5591 |
| 113 | Ga0466691_160224 | 3300042593 | Bacteria | 27887 |
| 114 | Ga0466694_139082 | 3300042594 | Bacteria | 5706 |
| 115 | Ga0466694_198102 | 3300042594 | Bacteria | 3618 |
| 116 | Ga0466694_284393 | 3300042594 | Bacteria | 8040 |
| 117 | Ga0466705_081280 | 3300042612 | Bacteria | 4170 |
| 118 | Ga0466719_024324 | 3300042606 | Bacteria | 1968 |
| 119 | Ga0466722_088142 | 3300042609 | Bacteria | 11867 |
| 120 | Ga0466722_106727 | 3300042609 | Bacteria | 11506 |
| 121 | Ga0466722_168945 | 3300042609 | Bacteria | 1730 |
| 122 | Ga0123355_10099713 | 3300009826 | Bacteria | 4577 |
| 123 | Ga0123355_10213793 | 3300009826 | Bacteria | 2788 |
| 124 | Ga0123353_10046810 | 3300010167 | Bacteria | 6877 |
| 125 | Ga0123353_10069907 | 3300010167 | Bacteria | 5640 |
| 126 | Ga0466735_009175 | 3300042624 | Bacteria | 2365 |
| 127 | Ga0466704_284658 | 3300042643 | Unclassified | 3784 |
| 128 | Ga0466708_101543 | 3300042652 | Bacteria | 4098 |
| 129 | Ga0466727_182967 | 3300042655 | Bacteria | 3078 |
| 130 | Ga0466712_134669 | 3300042614 | Bacteria | 13333 |
| 131 | Ga0466711_312387 | 3300042615 | Bacteria | 16329 |
| 132 | Ga0466723_271952 | 3300042618 | Bacteria | 4843 |
| 133 | Ga0466729_163170 | 3300042621 | Bacteria | 207322 |
| 134 | Ga0072941_1161324 | 3300005201 | Bacteria | 2192 |
| 135 | Ga0123357_10000033 | 3300009784 | Bacteria | 113776 |
| 136 | Ga0466690_192590 | 3300042590 | Bacteria | 8966 |
| 137 | Ga0466694_346577 | 3300042594 | Bacteria | 1668 |
| 138 | Ga0466699_078583 | 3300042597 | Bacteria | 1081 |
| 139 | Ga0466705_021493 | 3300042612 | Bacteria | 14502 |
| 140 | Ga0466705_064507 | 3300042612 | Bacteria | 9210 |
| 141 | Ga0466705_375020 | 3300042612 | Bacteria | 5278 |
| 142 | Ga0466707_377050 | 3300042601 | Bacteria | 1211 |
| 143 | Ga0466719_233511 | 3300042606 | Bacteria | 5353 |
| 144 | Ga0123356_10002407 | 3300010049 | Bacteria | 20024 |
| 145 | Ga0123356_10003429 | 3300010049 | Bacteria | 16603 |
| 146 | Ga0123354_10193024 | 3300010882 | Bacteria | 2271 |
| 147 | Ga0466704_222603 | 3300042643 | Bacteria | 60546 |
| 148 | Ga0466704_293402 | 3300042643 | Bacteria | 1675 |
| 149 | Ga0466709_127358 | 3300042648 | Bacteria | 18279 |
| 150 | Ga0466709_147740 | 3300042648 | Bacteria | 5306 |
| 151 | Ga0466708_039521 | 3300042652 | Bacteria | 3832 |
| 152 | Ga0466708_461551 | 3300042652 | Bacteria | 1704 |
| 153 | Ga0466712_148632 | 3300042614 | Bacteria | 1797 |
| 154 | Ga0466711_111753 | 3300042615 | Bacteria | 4822 |
| 155 | Ga0466711_192109 | 3300042615 | Bacteria | 2790 |
| 156 | Ga0466711_283817 | 3300042615 | Bacteria | 5209 |
| 157 | Ga0466718_084942 | 3300042617 | Bacteria | 1515 |
| 158 | Ga0466723_269484 | 3300042618 | Bacteria | 3182 |
| 159 | Ga0466723_288045 | 3300042618 | Unclassified | 3998 |
| 160 | Ga0466729_050171 | 3300042621 | Bacteria | 2764 |
| 161 | JGI24695J34938_10001833 | 3300002450 | Bacteria | 17337 |
| 162 | Ga0415639_127551 | 3300038395 | Bacteria | 3845 |
| 163 | Ga0466690_006391 | 3300042590 | Bacteria | 4056 |
| 164 | Ga0466705_237477 | 3300042612 | Bacteria | 4397 |
| 165 | Ga0466716_193208 | 3300042605 | Bacteria | 2745 |
| 166 | Ga0466716_467705 | 3300042605 | Bacteria | 8879 |
| 167 | Ga0466719_204308 | 3300042606 | Bacteria | 18675 |
| 168 | Ga0123353_10583603 | 3300010167 | Bacteria | 1603 |
| 169 | Ga0123353_10746629 | 3300010167 | Bacteria | 1363 |
| 170 | Ga0123354_10226964 | 3300010882 | Bacteria | 1965 |
| 171 | Ga0466703_083490 | 3300042636 | Bacteria | 11560 |
| 172 | Ga0466704_054474 | 3300042643 | Bacteria | 6087 |
| 173 | Ga0466704_068798 | 3300042643 | Bacteria | 3237 |
| 174 | Ga0466704_202245 | 3300042643 | Bacteria | 62547 |
| 175 | Ga0466708_120110 | 3300042652 | Bacteria | 21676 |
| 176 | Ga0466708_221722 | 3300042652 | Bacteria | 4437 |
| 177 | Ga0466727_226308 | 3300042655 | Bacteria | 1558 |
| 178 | Ga0466711_185972 | 3300042615 | Bacteria | 1479 |
| 179 | Ga0466723_018641 | 3300042618 | Bacteria | 57830 |
| 180 | Ga0466723_030944 | 3300042618 | Bacteria | 8107 |
| 181 | Ga0466728_249752 | 3300042620 | Bacteria | 11343 |
| 182 | JGI24695J34938_10062804 | 3300002450 | Bacteria | 1576 |
| 183 | Ga0072940_1027168 | 3300005200 | Bacteria | 4434 |
| 184 | Ga0072941_1105486 | 3300005201 | Bacteria | 3715 |
| 185 | Ga0072941_1161323 | 3300005201 | Bacteria | 2223 |
| 186 | Ga0105524_100227 | 3300007733 | Bacteria | 12639 |
| 187 | Ga0415639_042917 | 3300038395 | Bacteria | 4591 |
| 188 | Ga0466690_067040 | 3300042590 | Bacteria | 5015 |
| 189 | Ga0466692_068566 | 3300042591 | Bacteria | 34048 |
| 190 | Ga0466695_282155 | 3300042595 | Bacteria | 9918 |
| 191 | Ga0466695_287167 | 3300042595 | Bacteria | 1651 |
| 192 | Ga0466696_163279 | 3300042596 | Archaea | 4437 |
| 193 | Ga0466696_407706 | 3300042596 | Bacteria | 1588 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.