Protein Family IF09393

Metagenome Isolate
162 Members
50 Samples
151 Scaffolds
308.79 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_150000|Ga0466704_150000_10222_11268
Length
348 aa
Sequence
LSESRLSVPPPAGRAGIIKTAAVTALAGNLFLAVLKIGAGIHSGSMAVLGDGIDSSVDVLIALMSLMVSAVISRPADAGHPWGHGRAETVATAVLSFILFFAGAQLVLNSIVNVFSGSLRAVPGKIALAATAVSIIGKLILAWSQYRFSKKAVSAMLLANAKNMAADVIISAGVLAGLGLSMIFNLGAIDSVAAILVGLWIIKSAIGIFREANAELMDGGSETGSYRAVFDAVHSVKGAGRPHRARMRRIAGFWDIDIDIEVDPNLTVLEAHHIASQVEQAVKARLEGVYDIMIHVEPAGNTETEGFGLCEAAFSGGTGGQTVSKVPAAGYTQGGGESGDGIHERGKP

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Kalotermitidae 28.6%
Unclassified 24.5%
Termopsidae 8.2%
Rhinotermitidae 4.1%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 2
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
8 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
13 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
14 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
17 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2772190975 Treponema sp. RmG30 Isolate Blaberidae
29 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
30 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
31 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
32 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
40 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
41 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
42 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
43 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10021215 3300010167 Bacteria 9742
2 Ga0123353_10328329 3300010167 Bacteria 2317
3 Ga0466691_037477 3300042593 Bacteria 8832
4 Ga0466691_048757 3300042593 Bacteria 5452
5 Ga0466691_131868 3300042593 Bacteria 13463
6 Ga0466696_494623 3300042596 Bacteria 1309
7 Ga0466699_150539 3300042597 Bacteria 7264
8 Ga0466699_224685 3300042597 Bacteria 1755
9 Ga0466699_225424 3300042597 Bacteria 25238
10 Ga0466699_271348 3300042597 Bacteria 6453
11 Ga0466735_002824 3300042624 Bacteria 2866
12 Ga0466735_109972 3300042624 Bacteria 3095
13 Ga0466703_395122 3300042636 Bacteria 51270
14 Ga0466708_094298 3300042652 Bacteria 34608
15 Ga0466708_334123 3300042652 Bacteria 55617
16 Ga0466727_243152 3300042655 Bacteria 2657
17 JGI24702J35022_10009650 3300002462 Bacteria 5413
18 Ga0466716_008551 3300042605 Bacteria 3274
19 Ga0466719_064049 3300042606 Bacteria 9646
20 Ga0466719_106973 3300042606 Bacteria 29739
21 Ga0466719_515100 3300042606 Bacteria 3782
22 Ga0466722_205738 3300042609 Bacteria 4020
23 Ga0466705_516357 3300042612 Bacteria 5240
24 Ga0466705_078068 3300042612 Bacteria 6832
25 Ga0466705_107554 3300042612 Bacteria 51815
26 Ga0466705_146012 3300042612 Bacteria 5446
27 Ga0123353_10354977 3300010167 Bacteria 2207
28 Ga0466693_306910 3300042592 Bacteria 1978
29 Ga0466693_354034 3300042592 Bacteria 1046
30 Ga0466691_145840 3300042593 Bacteria 3333
31 Ga0466691_170012 3300042593 Bacteria 38393
32 Ga0466699_391055 3300042597 Bacteria 1446
33 Ga0466734_017481 3300042623 Bacteria 1620
34 Ga0466735_077041 3300042624 Bacteria 4161
35 Ga0466735_203569 3300042624 Bacteria 1196
36 Ga0466704_050012 3300042643 Bacteria 28642
37 Ga0466708_026869 3300042652 Bacteria 23353
38 Ga0466708_180930 3300042652 Bacteria 28002
39 Ga0466727_307575 3300042655 Bacteria 4446
40 Ga0466713_051608 3300042602 Bacteria 15387
41 Ga0466719_040941 3300042606 Bacteria 11354
42 Ga0466719_198559 3300042606 Bacteria 41330
43 Ga0466722_108418 3300042609 Bacteria 2174
44 Ga0466712_030831 3300042614 Bacteria 8751
45 Ga0466711_102447 3300042615 Bacteria 1960
46 Ga0466715_096439 3300042616 Bacteria 11717
47 Ga0466715_228501 3300042616 Bacteria 6327
48 Ga0466715_243549 3300042616 Bacteria 13882
49 Ga0466728_241551 3300042620 Bacteria 2388
50 Ga0415639_183358 3300038395 Bacteria 1813
51 Ga0466696_059708 3300042596 Bacteria 6370
52 Ga0466699_042156 3300042597 Bacteria 4511
53 Ga0466703_010528 3300042636 Bacteria 12005
54 Ga0466703_152808 3300042636 Bacteria 6052
55 Ga0466709_330050 3300042648 Unclassified 1676
56 JGI24695J34938_10000056 3300002450 Bacteria 90027
57 Ga0466722_260697 3300042609 Bacteria 5136
58 Ga0466711_025590 3300042615 Bacteria 41697
59 Ga0466715_032548 3300042616 Bacteria 5942
60 Ga0466715_097861 3300042616 Bacteria 28870
61 Ga0466715_243700 3300042616 Bacteria 14030
62 Ga0466726_019415 3300042619 Bacteria 3078
63 Ga0466728_074275 3300042620 Archaea 2943
64 Ga0466733_025864 3300042659 Bacteria 1097
65 Ga0466733_070378 3300042659 Bacteria 5419
66 Ga0466733_096343 3300042659 Archaea 5641
67 Ga0123355_10149223 3300009826 Bacteria 3556
68 Ga0466690_190948 3300042590 Bacteria 7905
69 Ga0466699_273821 3300042597 Bacteria 24467
70 Ga0466729_214010 3300042621 Bacteria 1283
71 Ga0466702_453167 3300042635 Bacteria 35795
72 Ga0466703_299289 3300042636 Bacteria 42101
73 Ga0466708_117433 3300042652 Bacteria 5485
74 Ga0466708_247106 3300042652 Bacteria 17278
75 Ga0466725_340443 3300042654 Bacteria 1185
76 JGI24695J34938_10039832 3300002450 Bacteria 2119
77 Ga0072941_1013071 3300005201 Bacteria 4931
78 Ga0466712_201317 3300042614 Bacteria 4337
79 Ga0466712_283203 3300042614 Bacteria 1756
80 Ga0466711_125348 3300042615 Bacteria 5289
81 Ga0466711_336895 3300042615 Bacteria 8777
82 Ga0466715_020972 3300042616 Bacteria 4918
83 Ga0466723_297867 3300042618 Bacteria 3847
84 Ga0466726_106933 3300042619 Bacteria 2959
85 Ga0466726_307099 3300042619 Bacteria 10650
86 Ga0466728_396949 3300042620 Bacteria 3671
87 Ga0466705_097728 3300042612 Bacteria 3154
88 Ga0466732_277535 3300042656 Bacteria 2436
89 Ga0123353_10000607 3300010167 Bacteria 43915
90 Ga0123353_10020754 3300010167 Bacteria 9828
91 Ga0123353_10067137 3300010167 Bacteria 5759
92 Ga0123353_10565371 3300010167 Bacteria 1636
93 Ga0466699_077058 3300042597 Bacteria 1948
94 Ga0466729_278148 3300042621 Bacteria 2941
95 Ga0466708_025650 3300042652 Bacteria 9449
96 Ga0466725_035820 3300042654 Unclassified 1764
97 Ga0466727_125991 3300042655 Bacteria 25498
98 JGI24698J34947_10004681 3300002449 Bacteria 7467
99 JGI24702J35022_10003691 3300002462 Bacteria 9212
100 Ga0466723_083510 3300042618 Bacteria 16681
101 Ga0466726_129985 3300042619 Bacteria 11594
102 Ga0466728_355860 3300042620 Bacteria 2850
103 Ga0466705_054038 3300042612 Bacteria 24746
104 Ga0466705_197819 3300042612 Bacteria 6966
105 Ga0123353_10016099 3300010167 Bacteria 10910
106 Ga0123353_10613989 3300010167 Bacteria 1550
107 Ga0466735_001917 3300042624 Bacteria 2864
108 Ga0466703_042652 3300042636 Bacteria 6914
109 Ga0466704_150000 3300042643 Bacteria 11947
110 Ga0466704_299159 3300042643 Bacteria 58999
111 Ga0466709_394666 3300042648 Bacteria 4809
112 Ga0466708_414427 3300042652 Bacteria 13597
113 JGI24695J34938_10000627 3300002450 Bacteria 33643
114 Ga0466716_144134 3300042605 Bacteria 27339
115 Ga0466716_383918 3300042605 Unclassified 1617
116 Ga0466711_243497 3300042615 Bacteria 28433
117 Ga0466723_074698 3300042618 Bacteria 11273
118 Ga0466723_319271 3300042618 Bacteria 5989
119 Ga0466726_288572 3300042619 Bacteria 2239
120 Ga0466726_320937 3300042619 Bacteria 1462
121 Ga0466726_451043 3300042619 Bacteria 2154
122 Ga0123353_10125650 3300010167 Bacteria 4122
123 Ga0123354_10009654 3300010882 Unclassified 14809
124 Ga0466699_060827 3300042597 Bacteria 12698
125 Ga0466699_079946 3300042597 Bacteria 2019
126 Ga0466699_171103 3300042597 Bacteria 1948
127 Ga0466709_271299 3300042648 Bacteria 3042
128 Ga0466709_316316 3300042648 Bacteria 3963
129 Ga0466708_162794 3300042652 Bacteria 2336
130 JGI24702J35022_10063012 3300002462 Unclassified 1986
131 Ga0466722_089922 3300042609 Bacteria 16066
132 Ga0466715_192391 3300042616 Bacteria 3672
133 Ga0466715_584290 3300042616 Bacteria 44080
134 Ga0466723_110458 3300042618 Unclassified 2375
135 Ga0466726_076299 3300042619 Bacteria 8984
136 Ga0466726_099110 3300042619 Bacteria 5537
137 Ga0123353_10030981 3300010167 Bacteria 8276
138 Ga0123353_10134018 3300010167 Bacteria 3974
139 Ga0123353_10720976 3300010167 Bacteria 1395
140 Ga0466690_045747 3300042590 Bacteria 6514
141 Ga0466704_395897 3300042643 Bacteria 4963
142 Ga0466709_292499 3300042648 Bacteria 1094
143 Ga0466708_056326 3300042652 Bacteria 4576
144 JGI24695J34938_10081368 3300002450 Bacteria 1337
145 Ga0068302_10085444 3300005071 Bacteria 1458
146 Ga0466707_100112 3300042601 Bacteria 2845
147 Ga0466714_029288 3300042603 Bacteria 19529
148 Ga0466716_031754 3300042605 Bacteria 3084
149 Ga0466716_088790 3300042605 Bacteria 15243
150 Ga0466723_324439 3300042618 Bacteria 6518
151 Ga0466726_234889 3300042619 Bacteria 4125

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01545 Cation_efflux Cation efflux family 24 217 0.98
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 226 299 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.