Protein Family IF09385

Metagenome Isolate
124 Members
38 Samples
115 Scaffolds
486.13 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_140178|Ga0466704_140178_15569_17179
Length
536 aa
Sequence
MVNHFKVSPVLSAAVGAGIGFYCLSVLFRTDIIGVYGIVAVFLIPTTVLSLLRVLVFFPAFFSAKNIEGSSEAGCLSWGRPLPDFRFVHLANRGVLAFAAGLALGLGMGGAAVNDISFGIPHNTVKAVSGVLLEDPRIVSGGRAMATLSLRETSGGGGLRVSAKGELPVFFPDESAARLREFGRGSVVFAEGNLRVSAYGTAGQEVPWLFSSESMHMVKPAPGLECFRTGLRLSLIRRFAPASVRSSASAGNGDYWGGLALALLLGIKDNLESGLSALYRDAGCSYVLALSGMHLAVLAAIIALLLKKPLGPRFAAIAGALIISIYCFIVGPLPSLIRAALMYLLGVLALLGALKREPLSLLGMAFLVQIVISPQSGFSLSFILSYLALVGILSAGEALNSIFKGKVPVCLLGPLSASLGAFLATAGVTAYFFGILRPVGIITGLVLVPLTTVFMIGSIAWLVLDFVSPFLSGFLNPALSLLYYLMEKTVSLAGQAPGFASGKPPLILALSLGLWLFLVCFEYRRRIAKNRIVAFV

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 52.8%
Unclassified 25.0%
Kalotermitidae 16.7%
Rhinotermitidae 5.6%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
19 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
32 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
33 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_091318 3300042656 Bacteria 8624
2 Ga0466702_024190 3300042635 Bacteria 2453
3 Ga0466702_154134 3300042635 Bacteria 22134
4 Ga0466704_140178 3300042643 Bacteria 60046
5 Ga0123356_10000125 3300010049 Bacteria 84722
6 Ga0415639_022188 3300038395 Bacteria 15573
7 Ga0415639_072901 3300038395 Bacteria 6473
8 Ga0466692_055727 3300042591 Bacteria 8589
9 Ga0466691_070342 3300042593 Bacteria 7373
10 Ga0466694_055897 3300042594 Bacteria 21390
11 Ga0466694_322816 3300042594 Bacteria 19824
12 Ga0466699_082500 3300042597 Bacteria 19471
13 Ga0466699_103536 3300042597 Bacteria 10825
14 JGI24698J34947_10000295 3300002449 Bacteria 21660
15 JGI24695J34938_10001318 3300002450 Bacteria 21600
16 Ga0072940_1023808 3300005200 Bacteria 3806
17 Ga0466718_108588 3300042617 Bacteria 22533
18 Ga0466731_388856 3300042622 Bacteria 12781
19 Ga0466702_197588 3300042635 Bacteria 25284
20 Ga0123356_10050087 3300010049 Bacteria 3888
21 Ga0466720_213637 3300042607 Bacteria 10509
22 Ga0264413_102233 3300024493 Bacteria 6779
23 Ga0466694_034645 3300042594 Bacteria 15920
24 Ga0466694_126938 3300042594 Bacteria 17529
25 Ga0466699_036221 3300042597 Bacteria 24269
26 Ga0466699_439518 3300042597 Bacteria 2457
27 JGI24698J34947_10002125 3300002449 Bacteria 10606
28 JGI24698J34947_10014153 3300002449 Bacteria 4344
29 Ga0072941_1014704 3300005201 Bacteria 8350
30 Ga0466712_257317 3300042614 Bacteria 24558
31 Ga0466718_095301 3300042617 Bacteria 25433
32 Ga0466731_012920 3300042622 Bacteria 154202
33 Ga0123356_10003652 3300010049 Bacteria 16035
34 Ga0123356_10031872 3300010049 Bacteria 4932
35 Ga0466720_176035 3300042607 Bacteria 8542
36 Ga0466720_211375 3300042607 Bacteria 60841
37 Ga0466722_014388 3300042609 Bacteria 2821
38 Ga0466690_041288 3300042590 Unclassified 13207
39 Ga0466694_234801 3300042594 Bacteria 9927
40 AustNasuHG_c1018509 3300000089 Bacteria 2297
41 JGI24695J34938_10002563 3300002450 Bacteria 13699
42 Ga0466712_179692 3300042614 Bacteria 22785
43 Ga0466718_011036 3300042617 Bacteria 3204
44 Ga0466705_266113 3300042612 Bacteria 67009
45 Ga0123353_10355469 3300010167 Bacteria 2205
46 Ga0466721_318431 3300042608 Bacteria 4483
47 Ga0264413_116292 3300024493 Bacteria 15643
48 Ga0466693_002405 3300042592 Bacteria 54310
49 JGI24698J34947_10002277 3300002449 Bacteria 10300
50 JGI24695J34938_10002492 3300002450 Bacteria 14008
51 Ga0072941_1009731 3300005201 Bacteria 23467
52 Ga0072941_1063995 3300005201 Bacteria 6367
53 Ga0072941_1137438 3300005201 Bacteria 5331
54 Ga0466718_091361 3300042617 Bacteria 4580
55 Ga0466731_370659 3300042622 Bacteria 3366
56 Ga0466702_229243 3300042635 Bacteria 14965
57 Ga0466702_390828 3300042635 Bacteria 3037
58 Ga0123356_10023190 3300010049 Bacteria 5845
59 Ga0123353_10540197 3300010167 Bacteria 1685
60 Ga0466720_193677 3300042607 Bacteria 15489
61 Ga0466722_186252 3300042609 Bacteria 5477
62 Ga0466698_154780 3300042610 Bacteria 2743
63 Ga0264413_125962 3300024493 Bacteria 10124
64 Ga0415639_147509 3300038395 Bacteria 5438
65 JGI24698J34947_10004849 3300002449 Bacteria 7363
66 Ga0072941_1080542 3300005201 Bacteria 5077
67 Ga0466702_141232 3300042635 Bacteria 3197
68 Ga0123353_10017028 3300010167 Bacteria 10656
69 Ga0466720_001662 3300042607 Bacteria 11322
70 Ga0466722_014187 3300042609 Bacteria 6361
71 Ga0264413_100040 3300024493 Bacteria 17360
72 Ga0466692_169787 3300042591 Bacteria 6728
73 Ga0466693_165874 3300042592 Unclassified 7773
74 JGI24698J34947_10000737 3300002449 Bacteria 16128
75 JGI24698J34947_10027031 3300002449 Bacteria 3045
76 JGI24695J34938_10000034 3300002450 Bacteria 102252
77 JGI24695J34938_10000990 3300002450 Bacteria 25802
78 JGI24695J34938_10002408 3300002450 Bacteria 14365
79 JGI24695J34938_10006408 3300002450 Bacteria 7077
80 Ga0072941_1013839 3300005201 Bacteria 8231
81 Ga0072941_1061086 3300005201 Bacteria 8981
82 Ga0466712_054107 3300042614 Bacteria 23105
83 Ga0466715_338079 3300042616 Bacteria 13937
84 Ga0466718_097017 3300042617 Bacteria 2013
85 Ga0466732_159474 3300042656 Bacteria 10234
86 Ga0466720_036827 3300042607 Bacteria 40262
87 Ga0466720_039534 3300042607 Bacteria 41363
88 Ga0264413_104053 3300024493 Bacteria 17683
89 Ga0466692_117410 3300042591 Bacteria 6992
90 Ga0466699_191805 3300042597 Bacteria 14269
91 Ga0466699_414897 3300042597 Bacteria 2375
92 JGI24698J34947_10013755 3300002449 Bacteria 4408
93 Ga0072941_1014673 3300005201 Bacteria 10615
94 Ga0072941_1044264 3300005201 Bacteria 8800
95 Ga0074263_114015 3300005485 Bacteria 3862
96 Ga0466712_022565 3300042614 Bacteria 13421
97 Ga0466712_074391 3300042614 Bacteria 3344
98 Ga0466712_101890 3300042614 Bacteria 13617
99 Ga0466712_271960 3300042614 Bacteria 7096
100 Ga0466712_297429 3300042614 Bacteria 2879
101 Ga0466723_022467 3300042618 Bacteria 12915
102 Ga0123356_10004241 3300010049 Bacteria 14836
103 Ga0123356_10007032 3300010049 Bacteria 11284
104 Ga0123356_10008249 3300010049 Unclassified 10366
105 Ga0466720_151681 3300042607 Bacteria 4698
106 Ga0264413_100418 3300024493 Bacteria 17878
107 Ga0466694_103890 3300042594 Bacteria 33875
108 Ga0466694_197691 3300042594 Bacteria 23512
109 Ga0466699_059908 3300042597 Unclassified 9948
110 AustNasuHG_c1000544 3300000089 Bacteria 13234
111 JGI24698J34947_10005776 3300002449 Bacteria 6785
112 JGI24698J34947_10008424 3300002449 Bacteria 5663
113 JGI24695J34938_10001007 3300002450 Bacteria 25572
114 Ga0072941_1114516 3300005201 Bacteria 2344
115 Ga0466718_012848 3300042617 Bacteria 2730

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03772 Competence Competence protein 263 524 0.91

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.