Protein Family IF09283

Metagenome Isolate
115 Members
36 Samples
108 Scaffolds
358.93 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_362209|Ga0466703_362209_50258_51442
Length
394 aa
Sequence
MQKILVGLSGGVDSAVASYLLKKQGFDIIGVMMSIWDNSYPIPKNKDMDACLGPEEDDIESVKKIADFLKIPLHILDCREEYKKVVIENFRNEYKQGRTPNPCVWCNAYIKFGVLPTTAKKHGLAFDKFATGHYANIKFNDSIGMYQLCKAFDETKDQTYFLYRLNQKILSQIVFPLGNLKKEEVRNIAKEIGMPVAQKPDSQDFYCGDYNDILQFPINSGDIIDKNGKVLGKHNGIWNYTIGKRKGLGLSGGTKEPLYVINILAKQNAIVVGPKEDLYSKCLTAVKVSWGSIAAPTQQIQVAVKIRQQHNPAKATITPIDKSSVKVDFQEAQMSITAGQSAVFYKDDVVLGGGIIWAASSCFKSSIGSFSLARSLSSIKTQNFSKCRFKLSQP

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.1%
Unclassified 25.0%
Termitidae 16.7%
Termopsidae 11.1%
Rhinotermitidae 5.6%
Hodotermitidae 2.8%
Formicidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
2 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
17 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
26 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_260692 3300042612 Unclassified 4898
2 Ga0466690_105966 3300042590 Bacteria 18205
3 Ga0466690_107088 3300042590 Bacteria 25813
4 Ga0466691_001046 3300042593 Unclassified 6777
5 Ga0466735_228412 3300042624 Bacteria 9341
6 Ga0466727_172156 3300042655 Bacteria 156225
7 Ga0466727_253697 3300042655 Bacteria 2268
8 Ga0466727_319284 3300042655 Bacteria 4229
9 Ga0466723_086043 3300042618 Bacteria 1456
10 Ga0466726_159837 3300042619 Bacteria 9298
11 Ga0466728_061894 3300042620 Bacteria 95675
12 Ga0466729_133905 3300042621 Bacteria 8185
13 Ga0466716_165265 3300042605 Bacteria 3559
14 Ga0466719_102704 3300042606 Bacteria 110867
15 Ga0466719_130653 3300042606 Bacteria 158630
16 Ga0068305_10000090 3300005083 Bacteria 152414
17 Ga0123357_10004024 3300009784 Bacteria 17105
18 Ga0466705_321631 3300042612 Bacteria 270475
19 Ga0466696_488094 3300042596 Bacteria 2754
20 Ga0466715_335964 3300042616 Bacteria 23808
21 Ga0466715_543880 3300042616 Bacteria 11794
22 Ga0466706_029158 3300042599 Bacteria 76030
23 Ga0466707_062878 3300042601 Bacteria 4547
24 Ga0466707_065717 3300042601 Bacteria 13822
25 Ga0466707_130842 3300042601 Bacteria 2757
26 Ga0466705_151846 3300042612 Bacteria 5436
27 Ga0466704_118816 3300042643 Unclassified 9817
28 Ga0466704_167270 3300042643 Bacteria 32596
29 Ga0466704_221449 3300042643 Bacteria 5748
30 Ga0466704_252284 3300042643 Bacteria 2844
31 Ga0466709_253029 3300042648 Bacteria 24232
32 Ga0466711_517825 3300042615 Bacteria 192770
33 Ga0466715_328331 3300042616 Bacteria 13295
34 Ga0466723_368798 3300042618 Unclassified 39965
35 Ga0466728_050538 3300042620 Bacteria 48589
36 Ga0466706_145545 3300042599 Bacteria 24377
37 Ga0466707_357026 3300042601 Bacteria 7258
38 Ga0466713_090790 3300042602 Bacteria 2956
39 Ga0466714_032663 3300042603 Bacteria 59155
40 Ga0466719_127211 3300042606 Bacteria 279481
41 Ga0466719_204137 3300042606 Bacteria 29278
42 Ga0466722_128210 3300042609 Bacteria 3298
43 Ga0068305_10000079 3300005083 Bacteria 163717
44 Ga0068305_10006619 3300005083 Unclassified 5338
45 Ga0123353_10000154 3300010167 Bacteria 86725
46 Ga0466705_143986 3300042612 Bacteria 113378
47 Ga0466690_055751 3300042590 Bacteria 148091
48 Ga0466690_302598 3300042590 Bacteria 2538
49 Ga0466691_002859 3300042593 Bacteria 11168
50 Ga0466735_120268 3300042624 Bacteria 6406
51 Ga0466735_174625 3300042624 Bacteria 7865
52 Ga0466715_469339 3300042616 Bacteria 13839
53 Ga0466723_256173 3300042618 Bacteria 1359
54 Ga0466728_306322 3300042620 Bacteria 70422
55 Ga0466707_134944 3300042601 Bacteria 69379
56 Ga0068302_10000023 3300005071 Bacteria 10178
57 Ga0123357_10237011 3300009784 Bacteria 1985
58 Ga0466729_269183 3300042621 Bacteria 17454
59 Ga0466735_156565 3300042624 Bacteria 2123
60 Ga0466726_152310 3300042619 Unclassified 4195
61 Ga0466726_214600 3300042619 Bacteria 58941
62 Ga0466728_003045 3300042620 Bacteria 90142
63 Ga0466706_088085 3300042599 Bacteria 25105
64 Ga0466706_203150 3300042599 Bacteria 155769
65 Ga0466700_417079 3300042600 Bacteria 69635
66 Ga0466713_070887 3300042602 Bacteria 102768
67 Ga0466716_085544 3300042605 Bacteria 17970
68 Ga0068302_10469606 3300005071 Bacteria 1572
69 Ga0123354_10000005 3300010882 Bacteria 283385
70 Ga0466690_302396 3300042590 Bacteria 3911
71 Ga0466696_337122 3300042596 Bacteria 2318
72 Ga0466735_013888 3300042624 Bacteria 9432
73 Ga0466735_058450 3300042624 Bacteria 31443
74 Ga0466703_110964 3300042636 Bacteria 165564
75 Ga0466711_036444 3300042615 Bacteria 5288
76 Ga0466711_261053 3300042615 Bacteria 39528
77 Ga0466723_271509 3300042618 Unclassified 38778
78 Ga0466707_314480 3300042601 Bacteria 9471
79 Ga0466690_351395 3300042590 Unclassified 15172
80 Ga0466691_144881 3300042593 Bacteria 142883
81 Ga0466696_161918 3300042596 Unclassified 2813
82 Ga0466729_291635 3300042621 Bacteria 3111
83 Ga0466703_395188 3300042636 Bacteria 299836
84 Ga0466704_188261 3300042643 Bacteria 31564
85 Ga0466704_224538 3300042643 Unclassified 18811
86 Ga0466711_157498 3300042615 Bacteria 313285
87 Ga0466711_355820 3300042615 Bacteria 54624
88 Ga0466715_127873 3300042616 Bacteria 35795
89 Ga0466715_436492 3300042616 Bacteria 169505
90 Ga0466726_078640 3300042619 Bacteria 41565
91 Ga0466716_190935 3300042605 Bacteria 6960
92 Ga0466705_171019 3300042612 Bacteria 78873
93 Ga0466705_358629 3300042612 Bacteria 19876
94 Ga0466703_362209 3300042636 Bacteria 54490
95 Ga0466704_050703 3300042643 Bacteria 35324
96 Ga0466727_277996 3300042655 Bacteria 60667
97 Ga0466711_135417 3300042615 Bacteria 2355
98 Ga0466711_343640 3300042615 Bacteria 4027
99 Ga0466711_372501 3300042615 Bacteria 489210
100 Ga0466715_141325 3300042616 Bacteria 38841
101 Ga0466715_517415 3300042616 Bacteria 23940
102 Ga0466723_086442 3300042618 Unclassified 40541
103 Ga0466729_062234 3300042621 Bacteria 8998
104 Ga0466729_072144 3300042621 Bacteria 3553
105 Ga0466707_158829 3300042601 Bacteria 178149
106 Ga0466713_153150 3300042602 Bacteria 5584
107 Ga0466719_459434 3300042606 Bacteria 2600
108 Ga0123356_10000184 3300010049 Bacteria 71830

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20258 tRNA_Me_trans_C Aminomethyltransferase beta-barrel domain 280 356 0.98
PF20259 tRNA_Me_trans_M tRNA methyl transferase PRC-barrel domain 219 273 0.95
PF03054 tRNA_Me_trans tRNA methyl transferase HUP domain 2 204 0.93

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.