Protein Family IF09280
Metagenome
Isolate
142
Members
43
Samples
128
Scaffolds
356.32
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_359078|Ga0466703_359078_990_2231
- Length
- 413 aa
- Sequence
- MEFEPRYMNLWFQDTSGEFLSSGVCVTIIITEAFELCLEKSDEGDDLMLVFNFTDAGSCAVFLKRQGIELTWRRIGIDALGAMAHGLFASLLIGTIMNTLGAQLGIPFLNQIGGFATAGTGAAMALSIGFALKAPPFVLYSLVAVGQAANSLGGSGGPLAVYFITLIAVFSGKLVSKITPVDLIISPFVTISAGISAAYLLAPPIGKIASSFGIAIMWATEMQPFLMGILISGIVGIVLTLPISSAAICAALGLVGLAGGAAVAGCCAHMVGFAVASWRENKIGGLMAQGLGTSMLQIPNLMKKPVLWLPAIAASLVNGPAATVIFKLKQNGPPISSGMGTSGMVGPIGVMSGWFAPSEAAAAIGEAAILPSYFDWLGLLMTSVIIPAVVAWLVSEWMRKRGIIKGRDLWIEC
Sample Types
Isolate
9.9%
Metagenome
90.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.6%
Unclassified
27.9%
Termitidae
14.0%
Blattidae
9.3%
Rhinotermitidae
7.0%
Termopsidae
7.0%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 2 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 3 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 4 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 5 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 14 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 15 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 23 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 24 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 30 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 38 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_123256 | 3300042612 | Bacteria | 13016 |
| 2 | Ga0466705_182467 | 3300042612 | Bacteria | 1996 |
| 3 | Ga0466705_284883 | 3300042612 | Bacteria | 1482 |
| 4 | Ga0466691_074690 | 3300042593 | Bacteria | 11649 |
| 5 | Ga0466715_398149 | 3300042616 | Bacteria | 6412 |
| 6 | Ga0466715_585035 | 3300042616 | Bacteria | 3933 |
| 7 | Ga0466723_002650 | 3300042618 | Bacteria | 6865 |
| 8 | Ga0466723_177756 | 3300042618 | Bacteria | 5719 |
| 9 | Ga0466726_389584 | 3300042619 | Bacteria | 26574 |
| 10 | Ga0466728_161257 | 3300042620 | Bacteria | 2090 |
| 11 | Ga0466703_173370 | 3300042636 | Bacteria | 27217 |
| 12 | Ga0466703_359078 | 3300042636 | Bacteria | 8054 |
| 13 | Ga0466703_427488 | 3300042636 | Bacteria | 3866 |
| 14 | Ga0466709_005784 | 3300042648 | Bacteria | 3760 |
| 15 | Ga0466709_038795 | 3300042648 | Bacteria | 3530 |
| 16 | Ga0466709_084217 | 3300042648 | Bacteria | 2257 |
| 17 | Ga0466708_160605 | 3300042652 | Bacteria | 83574 |
| 18 | Ga0466708_188574 | 3300042652 | Bacteria | 2954 |
| 19 | Ga0466705_053557 | 3300042612 | Unclassified | 1898 |
| 20 | Ga0466705_180165 | 3300042612 | Bacteria | 25536 |
| 21 | Ga0466733_017488 | 3300042659 | Bacteria | 1326 |
| 22 | Ga0466733_042525 | 3300042659 | Bacteria | 7817 |
| 23 | JGI24700J35501_10926148 | 3300002508 | Bacteria | 6116 |
| 24 | Ga0466691_192258 | 3300042593 | Bacteria | 1602 |
| 25 | Ga0466696_439838 | 3300042596 | Bacteria | 7511 |
| 26 | Ga0466706_001286 | 3300042599 | Bacteria | 1572 |
| 27 | Ga0466705_447973 | 3300042612 | Bacteria | 35979 |
| 28 | Ga0466705_454562 | 3300042612 | Bacteria | 3012 |
| 29 | Ga0466711_142387 | 3300042615 | Bacteria | 1817 |
| 30 | Ga0466711_179164 | 3300042615 | Bacteria | 3191 |
| 31 | Ga0466729_068731 | 3300042621 | Bacteria | 2250 |
| 32 | Ga0466704_226635 | 3300042643 | Bacteria | 9280 |
| 33 | Ga0466708_129630 | 3300042652 | Bacteria | 33659 |
| 34 | Ga0466708_278092 | 3300042652 | Unclassified | 3068 |
| 35 | Ga0466705_036824 | 3300042612 | Bacteria | 22429 |
| 36 | Ga0466705_372182 | 3300042612 | Bacteria | 2801 |
| 37 | Ga0068305_10019124 | 3300005083 | Bacteria | 3847 |
| 38 | Ga0466719_512157 | 3300042606 | Bacteria | 2887 |
| 39 | Ga0466722_174240 | 3300042609 | Bacteria | 7520 |
| 40 | Ga0466715_056349 | 3300042616 | Unclassified | 1691 |
| 41 | Ga0466715_242646 | 3300042616 | Bacteria | 23160 |
| 42 | Ga0466723_097650 | 3300042618 | Bacteria | 5344 |
| 43 | Ga0466735_211289 | 3300042624 | Bacteria | 1386 |
| 44 | Ga0466704_092665 | 3300042643 | Bacteria | 6285 |
| 45 | Ga0466708_111064 | 3300042652 | Bacteria | 18235 |
| 46 | Ga0466708_191665 | 3300042652 | Bacteria | 12709 |
| 47 | Ga0466708_450735 | 3300042652 | Bacteria | 18686 |
| 48 | Ga0466690_076973 | 3300042590 | Bacteria | 2047 |
| 49 | Ga0466690_145961 | 3300042590 | Bacteria | 2181 |
| 50 | Ga0466690_285581 | 3300042590 | Bacteria | 1106 |
| 51 | Ga0466692_010987 | 3300042591 | Bacteria | 14551 |
| 52 | Ga0466692_133251 | 3300042591 | Bacteria | 17825 |
| 53 | Ga0466691_006653 | 3300042593 | Bacteria | 4394 |
| 54 | Ga0466691_012106 | 3300042593 | Bacteria | 1616 |
| 55 | Ga0466691_095484 | 3300042593 | Bacteria | 8916 |
| 56 | Ga0466691_133993 | 3300042593 | Bacteria | 5506 |
| 57 | Ga0466694_178508 | 3300042594 | Bacteria | 5827 |
| 58 | Ga0466713_153592 | 3300042602 | Bacteria | 15136 |
| 59 | Ga0466715_206513 | 3300042616 | Bacteria | 2421 |
| 60 | Ga0466715_298786 | 3300042616 | Bacteria | 2487 |
| 61 | Ga0466723_053830 | 3300042618 | Bacteria | 8166 |
| 62 | Ga0466723_161923 | 3300042618 | Bacteria | 57130 |
| 63 | Ga0466723_333933 | 3300042618 | Bacteria | 1626 |
| 64 | Ga0466735_129835 | 3300042624 | Bacteria | 1759 |
| 65 | Ga0466703_049576 | 3300042636 | Bacteria | 16426 |
| 66 | Ga0466703_073878 | 3300042636 | Bacteria | 3802 |
| 67 | Ga0466704_000965 | 3300042643 | Unclassified | 7124 |
| 68 | Ga0466704_211305 | 3300042643 | Bacteria | 12560 |
| 69 | Ga0466709_275335 | 3300042648 | Unclassified | 1677 |
| 70 | Ga0466725_258295 | 3300042654 | Bacteria | 1578 |
| 71 | Ga0466705_327307 | 3300042612 | Bacteria | 1621 |
| 72 | JGI24700J35501_10930837 | 3300002508 | Bacteria | 26740 |
| 73 | Ga0466691_001363 | 3300042593 | Bacteria | 6176 |
| 74 | Ga0466696_065477 | 3300042596 | Bacteria | 1436 |
| 75 | Ga0466706_002630 | 3300042599 | Bacteria | 7832 |
| 76 | Ga0466706_100057 | 3300042599 | Bacteria | 2499 |
| 77 | Ga0466716_037464 | 3300042605 | Bacteria | 1376 |
| 78 | Ga0466711_230022 | 3300042615 | Bacteria | 2953 |
| 79 | Ga0466729_240474 | 3300042621 | Bacteria | 1579 |
| 80 | Ga0466735_083968 | 3300042624 | Bacteria | 8231 |
| 81 | Ga0466704_127917 | 3300042643 | Unclassified | 2137 |
| 82 | Ga0466704_129782 | 3300042643 | Unclassified | 8385 |
| 83 | Ga0466704_330539 | 3300042643 | Bacteria | 3275 |
| 84 | Ga0466705_146339 | 3300042612 | Bacteria | 3415 |
| 85 | Ga0466705_269929 | 3300042612 | Bacteria | 10575 |
| 86 | JGI24702J35022_10000037 | 3300002462 | Bacteria | 54731 |
| 87 | Ga0466691_151152 | 3300042593 | Bacteria | 11620 |
| 88 | Ga0466691_185067 | 3300042593 | Bacteria | 34627 |
| 89 | Ga0466711_429294 | 3300042615 | Bacteria | 13985 |
| 90 | Ga0466715_042670 | 3300042616 | Bacteria | 29859 |
| 91 | Ga0466726_132862 | 3300042619 | Bacteria | 10282 |
| 92 | Ga0466726_442868 | 3300042619 | Bacteria | 3607 |
| 93 | Ga0466703_188874 | 3300042636 | Bacteria | 12410 |
| 94 | Ga0466704_458336 | 3300042643 | Bacteria | 2204 |
| 95 | Ga0466704_517751 | 3300042643 | Bacteria | 17843 |
| 96 | Ga0466708_061004 | 3300042652 | Bacteria | 4209 |
| 97 | Ga0466708_091788 | 3300042652 | Bacteria | 1344 |
| 98 | Ga0466708_200651 | 3300042652 | Bacteria | 7113 |
| 99 | JGI24702J35022_10003840 | 3300002462 | Bacteria | 9014 |
| 100 | JGI24700J35501_10929746 | 3300002508 | Bacteria | 10058 |
| 101 | Ga0466706_112633 | 3300042599 | Bacteria | 1273 |
| 102 | Ga0466716_525234 | 3300042605 | Unclassified | 2345 |
| 103 | Ga0466715_338757 | 3300042616 | Bacteria | 7236 |
| 104 | Ga0466723_340910 | 3300042618 | Bacteria | 3339 |
| 105 | Ga0466726_327465 | 3300042619 | Bacteria | 8020 |
| 106 | Ga0466735_121530 | 3300042624 | Bacteria | 7421 |
| 107 | Ga0466703_273974 | 3300042636 | Bacteria | 93063 |
| 108 | Ga0466727_347112 | 3300042655 | Bacteria | 14728 |
| 109 | Ga0466690_118658 | 3300042590 | Bacteria | 5585 |
| 110 | Ga0466691_078110 | 3300042593 | Bacteria | 7473 |
| 111 | Ga0466706_238630 | 3300042599 | Bacteria | 5122 |
| 112 | Ga0466713_115057 | 3300042602 | Bacteria | 32652 |
| 113 | Ga0466714_003597 | 3300042603 | Bacteria | 1750 |
| 114 | Ga0466714_004022 | 3300042603 | Unclassified | 1745 |
| 115 | Ga0466716_084365 | 3300042605 | Bacteria | 12151 |
| 116 | Ga0466719_536208 | 3300042606 | Bacteria | 2181 |
| 117 | Ga0466715_335953 | 3300042616 | Bacteria | 52537 |
| 118 | Ga0466723_325934 | 3300042618 | Bacteria | 6551 |
| 119 | Ga0466728_240810 | 3300042620 | Bacteria | 3377 |
| 120 | Ga0466728_385864 | 3300042620 | Bacteria | 3085 |
| 121 | Ga0466728_386802 | 3300042620 | Bacteria | 3222 |
| 122 | Ga0466703_073313 | 3300042636 | Bacteria | 9732 |
| 123 | Ga0466703_397532 | 3300042636 | Unclassified | 2290 |
| 124 | Ga0466704_035569 | 3300042643 | Bacteria | 21995 |
| 125 | Ga0466704_352707 | 3300042643 | Bacteria | 6343 |
| 126 | Ga0466704_475775 | 3300042643 | Bacteria | 4123 |
| 127 | Ga0466709_099108 | 3300042648 | Bacteria | 3925 |
| 128 | Ga0466708_303590 | 3300042652 | Bacteria | 35536 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13303 | PTS_EIIC_2 | Phosphotransferase system, EIIC | 78 | 409 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.