Protein Family IF09269
Metagenome
Isolate
134
Members
42
Samples
130
Scaffolds
192.67
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_337384|Ga0466703_337384_2079_2747
- Length
- 222 aa
- Sequence
- LKEQPKGSLGGNELANEGKSAILWAGEFMEPIILASGSLRRQEFFRLLGLPFSIMPPLIDEQIVQGVEPRKMAENFAVMKVKKVVELMKGRIPAWVCGADTIISVDGVIYGKPKDREDAGAMLSRLQGREHEVITAVALKNREGVIDCRSVVSLVSFACLSEQEIEWYLNTGEWQGVAGSYKIQGLASCYITGIKGSPSAVVGLPMNEFYVMLRNNGYPYGG
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.5%
Kalotermitidae
33.3%
Unclassified
14.3%
Termopsidae
9.5%
Rhinotermitidae
2.4%
Taxonomy
Archaea
1
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 27 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_209330 | 3300042593 | Bacteria | 7873 |
| 2 | Ga0466707_049136 | 3300042601 | Bacteria | 1015 |
| 3 | Ga0466719_444651 | 3300042606 | Bacteria | 35344 |
| 4 | Ga0068305_10439010 | 3300005083 | Bacteria | 8719 |
| 5 | Ga0466703_181939 | 3300042636 | Bacteria | 6903 |
| 6 | Ga0466703_380717 | 3300042636 | Bacteria | 5510 |
| 7 | Ga0466727_272285 | 3300042655 | Bacteria | 1582 |
| 8 | Ga0466712_163367 | 3300042614 | Bacteria | 5458 |
| 9 | Ga0466711_433757 | 3300042615 | Bacteria | 1383 |
| 10 | Ga0466723_291555 | 3300042618 | Bacteria | 20915 |
| 11 | Ga0123356_10314216 | 3300010049 | Bacteria | 1677 |
| 12 | Ga0466707_356942 | 3300042601 | Bacteria | 2015 |
| 13 | Ga0466716_088441 | 3300042605 | Bacteria | 1455 |
| 14 | Ga0466719_035069 | 3300042606 | Bacteria | 14650 |
| 15 | Ga0466719_123044 | 3300042606 | Bacteria | 2006 |
| 16 | Ga0466719_264379 | 3300042606 | Bacteria | 14167 |
| 17 | JGI24698J34947_10081186 | 3300002449 | Bacteria | 1521 |
| 18 | Ga0466735_009925 | 3300042624 | Unclassified | 1429 |
| 19 | Ga0466735_038334 | 3300042624 | Bacteria | 1226 |
| 20 | Ga0466708_135741 | 3300042652 | Bacteria | 11662 |
| 21 | Ga0466708_279571 | 3300042652 | Bacteria | 4449 |
| 22 | Ga0466727_031941 | 3300042655 | Bacteria | 9421 |
| 23 | Ga0466705_416718 | 3300042612 | Bacteria | 2060 |
| 24 | Ga0466723_299807 | 3300042618 | Bacteria | 1038 |
| 25 | Ga0466728_108495 | 3300042620 | Bacteria | 1174 |
| 26 | Ga0466728_376125 | 3300042620 | Bacteria | 1390 |
| 27 | Ga0466691_024704 | 3300042593 | Bacteria | 6075 |
| 28 | Ga0466695_158964 | 3300042595 | Bacteria | 5318 |
| 29 | Ga0123356_10003994 | 3300010049 | Bacteria | 15325 |
| 30 | Ga0123356_10018720 | 3300010049 | Bacteria | 6573 |
| 31 | Ga0123356_10154711 | 3300010049 | Bacteria | 2282 |
| 32 | Ga0466701_068615 | 3300042598 | Bacteria | 1321 |
| 33 | Ga0466722_191664 | 3300042609 | Bacteria | 1344 |
| 34 | Ga0068302_10380652 | 3300005071 | Bacteria | 941 |
| 35 | Ga0466703_132938 | 3300042636 | Bacteria | 17353 |
| 36 | Ga0466704_132165 | 3300042643 | Bacteria | 35160 |
| 37 | Ga0466704_309373 | 3300042643 | Bacteria | 19706 |
| 38 | Ga0466709_194612 | 3300042648 | Bacteria | 25927 |
| 39 | Ga0466708_103796 | 3300042652 | Bacteria | 41820 |
| 40 | Ga0466715_120929 | 3300042616 | Bacteria | 51611 |
| 41 | Ga0466728_103292 | 3300042620 | Bacteria | 2577 |
| 42 | Ga0466728_171577 | 3300042620 | Bacteria | 15599 |
| 43 | Ga0466690_313579 | 3300042590 | Bacteria | 41778 |
| 44 | Ga0466694_105188 | 3300042594 | Bacteria | 1380 |
| 45 | Ga0466696_093990 | 3300042596 | Bacteria | 3526 |
| 46 | Ga0123356_10079176 | 3300010049 | Bacteria | 3104 |
| 47 | Ga0466719_385575 | 3300042606 | Bacteria | 2376 |
| 48 | AustNasuHG_c1006399 | 3300000089 | Bacteria | 4204 |
| 49 | JGI24698J34947_10006352 | 3300002449 | Bacteria | 6489 |
| 50 | JGI24698J34947_10022727 | 3300002449 | Unclassified | 3359 |
| 51 | Ga0466735_146783 | 3300042624 | Bacteria | 1003 |
| 52 | Ga0466703_024259 | 3300042636 | Bacteria | 18505 |
| 53 | Ga0466703_159061 | 3300042636 | Bacteria | 19395 |
| 54 | Ga0466704_090508 | 3300042643 | Bacteria | 16651 |
| 55 | Ga0466712_108856 | 3300042614 | Bacteria | 1444 |
| 56 | Ga0466712_274160 | 3300042614 | Bacteria | 2112 |
| 57 | Ga0466718_036173 | 3300042617 | Bacteria | 1058 |
| 58 | Ga0466723_024654 | 3300042618 | Bacteria | 62216 |
| 59 | Ga0466723_036819 | 3300042618 | Bacteria | 9481 |
| 60 | Ga0466723_126542 | 3300042618 | Unclassified | 1240 |
| 61 | Ga0466726_036320 | 3300042619 | Bacteria | 3194 |
| 62 | Ga0466726_184786 | 3300042619 | Bacteria | 1125 |
| 63 | Ga0466728_123097 | 3300042620 | Bacteria | 3426 |
| 64 | Ga0466705_078278 | 3300042612 | Bacteria | 19606 |
| 65 | Ga0466705_182822 | 3300042612 | Bacteria | 4992 |
| 66 | Ga0466732_114721 | 3300042656 | Bacteria | 1523 |
| 67 | Ga0466733_149052 | 3300042659 | Bacteria | 16557 |
| 68 | Ga0466691_135382 | 3300042593 | Bacteria | 8694 |
| 69 | Ga0466696_105547 | 3300042596 | Bacteria | 6775 |
| 70 | Ga0466699_237898 | 3300042597 | Bacteria | 13519 |
| 71 | Ga0466699_424683 | 3300042597 | Bacteria | 2379 |
| 72 | Ga0466699_427434 | 3300042597 | Bacteria | 1374 |
| 73 | Ga0123354_10041677 | 3300010882 | Bacteria | 7092 |
| 74 | Ga0466707_094954 | 3300042601 | Bacteria | 1291 |
| 75 | JGI24698J34947_10000409 | 3300002449 | Bacteria | 19605 |
| 76 | JGI24698J34947_10009127 | 3300002449 | Bacteria | 5443 |
| 77 | Ga0466734_075826 | 3300042623 | Bacteria | 1906 |
| 78 | Ga0466735_077974 | 3300042624 | Bacteria | 16776 |
| 79 | Ga0466703_337384 | 3300042636 | Bacteria | 14779 |
| 80 | Ga0466704_046500 | 3300042643 | Bacteria | 45746 |
| 81 | Ga0466709_066227 | 3300042648 | Bacteria | 30258 |
| 82 | Ga0466708_215966 | 3300042652 | Bacteria | 9299 |
| 83 | Ga0466712_173060 | 3300042614 | Bacteria | 15755 |
| 84 | Ga0466711_165879 | 3300042615 | Bacteria | 18740 |
| 85 | Ga0466715_041382 | 3300042616 | Bacteria | 5685 |
| 86 | Ga0466733_150505 | 3300042659 | Bacteria | 1298 |
| 87 | Ga0466733_194515 | 3300042659 | Bacteria | 1105 |
| 88 | Ga0415639_212173 | 3300038395 | Bacteria | 2801 |
| 89 | Ga0466690_353635 | 3300042590 | Bacteria | 7026 |
| 90 | Ga0466691_075760 | 3300042593 | Bacteria | 16613 |
| 91 | Ga0466694_006279 | 3300042594 | Bacteria | 29816 |
| 92 | Ga0466699_309128 | 3300042597 | Archaea | 2488 |
| 93 | Ga0466716_260633 | 3300042605 | Bacteria | 7818 |
| 94 | JGI24698J34947_10000688 | 3300002449 | Bacteria | 16494 |
| 95 | JGI24698J34947_10037305 | 3300002449 | Bacteria | 2526 |
| 96 | Ga0466704_063886 | 3300042643 | Bacteria | 26674 |
| 97 | Ga0466712_037568 | 3300042614 | Bacteria | 7893 |
| 98 | Ga0466715_065478 | 3300042616 | Bacteria | 25951 |
| 99 | Ga0466726_095381 | 3300042619 | Bacteria | 5717 |
| 100 | Ga0466733_022655 | 3300042659 | Bacteria | 1883 |
| 101 | Ga0466733_089083 | 3300042659 | Bacteria | 2926 |
| 102 | Ga0466690_210682 | 3300042590 | Bacteria | 5057 |
| 103 | Ga0466691_070315 | 3300042593 | Bacteria | 2904 |
| 104 | Ga0466694_117912 | 3300042594 | Bacteria | 1787 |
| 105 | Ga0123355_10274975 | 3300009826 | Bacteria | 2334 |
| 106 | Ga0123353_10805341 | 3300010167 | Unclassified | 1296 |
| 107 | Ga0466716_021401 | 3300042605 | Bacteria | 18251 |
| 108 | Ga0466716_051922 | 3300042605 | Bacteria | 10059 |
| 109 | Ga0466716_161805 | 3300042605 | Bacteria | 10935 |
| 110 | JGI24698J34947_10046265 | 3300002449 | Bacteria | 2215 |
| 111 | JGI24698J34947_10046514 | 3300002449 | Bacteria | 2206 |
| 112 | Ga0466735_205134 | 3300042624 | Bacteria | 2305 |
| 113 | Ga0466733_031282 | 3300042659 | Bacteria | 2061 |
| 114 | Ga0466691_226094 | 3300042593 | Bacteria | 11447 |
| 115 | Ga0466695_151841 | 3300042595 | Bacteria | 41232 |
| 116 | Ga0466699_382647 | 3300042597 | Bacteria | 4758 |
| 117 | Ga0123356_10847773 | 3300010049 | Bacteria | 1085 |
| 118 | Ga0123356_12367891 | 3300010049 | Bacteria | 664 |
| 119 | Ga0466722_156992 | 3300042609 | Bacteria | 2254 |
| 120 | JGI24698J34947_10087798 | 3300002449 | Bacteria | 1437 |
| 121 | JGI24695J34938_10002164 | 3300002450 | Bacteria | 15336 |
| 122 | JGI24695J34938_10035616 | 3300002450 | Bacteria | 2275 |
| 123 | Ga0466735_235967 | 3300042624 | Bacteria | 1555 |
| 124 | Ga0466703_353040 | 3300042636 | Bacteria | 4047 |
| 125 | Ga0466712_051941 | 3300042614 | Bacteria | 37403 |
| 126 | Ga0466712_162563 | 3300042614 | Bacteria | 4208 |
| 127 | Ga0466715_157935 | 3300042616 | Bacteria | 23735 |
| 128 | Ga0466718_013852 | 3300042617 | Bacteria | 2654 |
| 129 | Ga0466726_187813 | 3300042619 | Bacteria | 1995 |
| 130 | Ga0466728_146625 | 3300042620 | Bacteria | 1608 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02545 | Maf | Maf-like protein | 31 | 215 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02545 | GO:0047429 | nucleoside triphosphate diphosphatase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.