Protein Family IF09199
Metagenome
Isolate
119
Members
43
Samples
113
Scaffolds
363.8
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_212183|Ga0466703_212183_584_1891
- Length
- 413 aa
- Sequence
- MKKQPDTSIREAQAEIGPKIRTKVLSPGNYPLQIAGRTPLKPVKPWAVFFLALGIGVCAFAGGSKDSGKGPAASGQSGGKSSTDTLKVGFVYIGAINDEGYTQAHDKGRLAIEALGIKTAYIENVAENADCEKAIRDLIDQGCNVIYTNSFGFMDWTIKVAADNPSVYFGHCSGYKRAANVSTYFGKIYQARYLSGIVAGLKTTANHIGYVAAMPIPEVIRGINAFTLGVQSVNPEATVEVIWTNTWYDPSVEKQAALELLNQGCDVIAQHQDTTAPQIAAQERGAFAVGYNVPTASAAPRAYLTAPLFHWEVFYLDDVKSILAGTWKSRAYWEGFSNGTVSLDTLTGNNAPETAEKIAEVKTQIIEGAFDPFTGPLTDQGGTLKVASGVKMSDDEIWNMSWFVQGVIGTIPQ
Sample Types
Isolate
5.0%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
31.0%
Unclassified
21.4%
Rhinotermitidae
7.1%
Termopsidae
7.1%
Taxonomy
Archaea
0
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 9 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 24 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 36 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 37 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466720_153412 | 3300042607 | Bacteria | 30506 |
| 2 | Ga0466698_318527 | 3300042610 | Bacteria | 5599 |
| 3 | Ga0466703_011851 | 3300042636 | Bacteria | 33424 |
| 4 | Ga0466709_265919 | 3300042648 | Bacteria | 4899 |
| 5 | Ga0466712_322406 | 3300042614 | Bacteria | 2880 |
| 6 | Ga0466711_168924 | 3300042615 | Bacteria | 2419 |
| 7 | Ga0466711_245930 | 3300042615 | Bacteria | 4889 |
| 8 | Ga0466723_194380 | 3300042618 | Bacteria | 46497 |
| 9 | Ga0466723_229778 | 3300042618 | Bacteria | 6132 |
| 10 | Ga0466726_193769 | 3300042619 | Bacteria | 2793 |
| 11 | JGI24698J34947_10002749 | 3300002449 | Bacteria | 9517 |
| 12 | JGI24698J34947_10008242 | 3300002449 | Bacteria | 5715 |
| 13 | JGI24698J34947_10061850 | 3300002449 | Unclassified | 1840 |
| 14 | JGI24699J35502_11132041 | 3300002509 | Bacteria | 6316 |
| 15 | Ga0466716_025395 | 3300042605 | Bacteria | 11916 |
| 16 | Ga0466720_055001 | 3300042607 | Bacteria | 5024 |
| 17 | Ga0466720_179624 | 3300042607 | Bacteria | 23019 |
| 18 | Ga0466722_122485 | 3300042609 | Bacteria | 7407 |
| 19 | Ga0466690_098884 | 3300042590 | Bacteria | 9534 |
| 20 | Ga0466690_101534 | 3300042590 | Bacteria | 2985 |
| 21 | Ga0466691_133139 | 3300042593 | Bacteria | 14278 |
| 22 | Ga0466691_221782 | 3300042593 | Bacteria | 4832 |
| 23 | Ga0466696_426519 | 3300042596 | Bacteria | 1767 |
| 24 | Ga0466699_013938 | 3300042597 | Bacteria | 12819 |
| 25 | Ga0466699_049632 | 3300042597 | Bacteria | 9016 |
| 26 | Ga0466735_205567 | 3300042624 | Bacteria | 2147 |
| 27 | Ga0466703_377616 | 3300042636 | Bacteria | 7547 |
| 28 | Ga0466709_195623 | 3300042648 | Bacteria | 12818 |
| 29 | Ga0466711_077883 | 3300042615 | Bacteria | 2655 |
| 30 | Ga0466711_194219 | 3300042615 | Bacteria | 2013 |
| 31 | Ga0466715_169434 | 3300042616 | Bacteria | 34287 |
| 32 | Ga0466715_236808 | 3300042616 | Bacteria | 11381 |
| 33 | Ga0466723_240797 | 3300042618 | Bacteria | 40146 |
| 34 | Ga0466726_123362 | 3300042619 | Bacteria | 2727 |
| 35 | Ga0466726_308624 | 3300042619 | Bacteria | 2957 |
| 36 | JGI24698J34947_10005738 | 3300002449 | Bacteria | 6806 |
| 37 | JGI24698J34947_10043068 | 3300002449 | Bacteria | 2316 |
| 38 | JGI24695J34938_10010109 | 3300002450 | Bacteria | 5198 |
| 39 | Ga0466719_514470 | 3300042606 | Bacteria | 1585 |
| 40 | Ga0466698_071886 | 3300042610 | Bacteria | 1601 |
| 41 | Ga0123353_10000006 | 3300010167 | Bacteria | 279423 |
| 42 | Ga0466690_090833 | 3300042590 | Bacteria | 11508 |
| 43 | Ga0466690_274431 | 3300042590 | Bacteria | 6570 |
| 44 | Ga0466691_023198 | 3300042593 | Bacteria | 6090 |
| 45 | Ga0466691_146404 | 3300042593 | Bacteria | 1412 |
| 46 | Ga0466694_243185 | 3300042594 | Bacteria | 1327 |
| 47 | Ga0466703_212183 | 3300042636 | Bacteria | 5649 |
| 48 | Ga0466704_459937 | 3300042643 | Bacteria | 17868 |
| 49 | Ga0466727_200820 | 3300042655 | Bacteria | 4826 |
| 50 | Ga0466705_078857 | 3300042612 | Bacteria | 8457 |
| 51 | Ga0466723_053639 | 3300042618 | Bacteria | 12699 |
| 52 | Ga0466723_153797 | 3300042618 | Bacteria | 5760 |
| 53 | JGI24698J34947_10004085 | 3300002449 | Bacteria | 7915 |
| 54 | Ga0466707_351736 | 3300042601 | Bacteria | 1593 |
| 55 | Ga0466717_144307 | 3300042604 | Bacteria | 1828 |
| 56 | Ga0466719_059333 | 3300042606 | Bacteria | 11720 |
| 57 | Ga0466704_094999 | 3300042643 | Bacteria | 61949 |
| 58 | Ga0466704_587653 | 3300042643 | Bacteria | 3258 |
| 59 | Ga0466708_315814 | 3300042652 | Bacteria | 5410 |
| 60 | Ga0466712_239992 | 3300042614 | Bacteria | 2392 |
| 61 | Ga0466711_060677 | 3300042615 | Bacteria | 10656 |
| 62 | JGI24698J34947_10001072 | 3300002449 | Bacteria | 14070 |
| 63 | JGI24698J34947_10006776 | 3300002449 | Bacteria | 6293 |
| 64 | JGI24698J34947_10028422 | 3300002449 | Unclassified | 2960 |
| 65 | Ga0068305_10142616 | 3300005083 | Bacteria | 9272 |
| 66 | Ga0466732_114340 | 3300042656 | Bacteria | 7098 |
| 67 | Ga0466707_238514 | 3300042601 | Bacteria | 1782 |
| 68 | Ga0123353_10049238 | 3300010167 | Bacteria | 6712 |
| 69 | Ga0466703_021634 | 3300042636 | Bacteria | 2949 |
| 70 | Ga0466704_116351 | 3300042643 | Bacteria | 6593 |
| 71 | Ga0466704_186473 | 3300042643 | Bacteria | 5098 |
| 72 | Ga0466709_307458 | 3300042648 | Bacteria | 20760 |
| 73 | Ga0466715_428201 | 3300042616 | Bacteria | 1502 |
| 74 | Ga0466726_248436 | 3300042619 | Bacteria | 16954 |
| 75 | JGI24698J34947_10017061 | 3300002449 | Bacteria | 3938 |
| 76 | JGI24698J34947_10028453 | 3300002449 | Bacteria | 2958 |
| 77 | Ga0456237_0002461 | 3300041968 | Unclassified | 2998 |
| 78 | Ga0466690_072249 | 3300042590 | Bacteria | 6881 |
| 79 | Ga0466692_043079 | 3300042591 | Bacteria | 14219 |
| 80 | Ga0466691_050216 | 3300042593 | Unclassified | 6367 |
| 81 | JGI24698J34947_10029707 | 3300002449 | Unclassified | 2886 |
| 82 | JGI24698J34947_10043943 | 3300002449 | Bacteria | 2288 |
| 83 | JGI24702J35022_10028721 | 3300002462 | Bacteria | 2987 |
| 84 | Ga0072941_1005277 | 3300005201 | Bacteria | 11744 |
| 85 | Ga0466732_428542 | 3300042656 | Bacteria | 3624 |
| 86 | Ga0466719_062250 | 3300042606 | Bacteria | 5475 |
| 87 | Ga0466690_105467 | 3300042590 | Bacteria | 2922 |
| 88 | Ga0466692_093202 | 3300042591 | Bacteria | 5806 |
| 89 | Ga0466691_046864 | 3300042593 | Bacteria | 7165 |
| 90 | Ga0466699_117847 | 3300042597 | Bacteria | 18652 |
| 91 | Ga0466699_303477 | 3300042597 | Bacteria | 2916 |
| 92 | Ga0466703_044208 | 3300042636 | Bacteria | 3431 |
| 93 | Ga0466703_265917 | 3300042636 | Bacteria | 4816 |
| 94 | Ga0466704_103233 | 3300042643 | Bacteria | 3356 |
| 95 | Ga0466709_275987 | 3300042648 | Bacteria | 16469 |
| 96 | Ga0466727_041444 | 3300042655 | Bacteria | 5903 |
| 97 | Ga0466712_206989 | 3300042614 | Bacteria | 5924 |
| 98 | Ga0466726_239069 | 3300042619 | Bacteria | 26158 |
| 99 | Ga0466726_286331 | 3300042619 | Bacteria | 1360 |
| 100 | Ga0466713_025359 | 3300042602 | Bacteria | 8367 |
| 101 | Ga0466722_007201 | 3300042609 | Bacteria | 2163 |
| 102 | Ga0466696_454256 | 3300042596 | Bacteria | 1458 |
| 103 | Ga0466699_002180 | 3300042597 | Bacteria | 1675 |
| 104 | Ga0466704_202319 | 3300042643 | Bacteria | 1418 |
| 105 | Ga0466727_237172 | 3300042655 | Bacteria | 27933 |
| 106 | Ga0466705_050529 | 3300042612 | Bacteria | 30966 |
| 107 | Ga0466718_070913 | 3300042617 | Unclassified | 8015 |
| 108 | Ga0466726_447172 | 3300042619 | Bacteria | 5944 |
| 109 | Ga0466728_101046 | 3300042620 | Bacteria | 27672 |
| 110 | Ga0466728_190199 | 3300042620 | Bacteria | 4446 |
| 111 | Ga0466728_227552 | 3300042620 | Bacteria | 12367 |
| 112 | JGI24698J34947_10024966 | 3300002449 | Bacteria | 3185 |
| 113 | JGI24702J35022_10015248 | 3300002462 | Bacteria | 4234 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02608 | Bmp | ABC transporter substrate-binding protein PnrA-like | 87 | 367 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02608 | GO:0005886 | plasma membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.