Protein Family IF09167

Metagenome Isolate
127 Members
30 Samples
126 Scaffolds
258.76 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_161494|Ga0466703_161494_8253_9143
Length
296 aa
Sequence
VKNQAVTEKGGGTKTRKREKISQDIYALDGETITIYSIVMIGFLIKKTFFDMWDNLFRVALINLGFIASVAIPVFIPGLLEPFPVLAVGVIFIGVLWCFVYLAAAALSLKSVSDYGSFGFGDFFNNLKSAWPIGLVMGGFVLIILVLVRVVIPFYLDMQSMVGLLLAAVIFWTIVVGILSFQFLLAVRVRLDTKITKIIKKCFLFFFDNTGFCIFSFIHNVIALGISMFLAFLFPGPAGLLLYLDEALRLRLLKYDWLEANPGENRRKIPWDALLIDDRERTGTRSLKSFIFPWKD

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 48.3%
Termitidae 31.0%
Rhinotermitidae 10.3%
Termopsidae 6.9%
Unclassified 3.4%

🌳 Taxonomy

Archaea 1
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
8 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
9 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
10 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10074745 3300010882 Bacteria 4851
2 Ga0466716_081874 3300042605 Bacteria 15222
3 Ga0466716_261930 3300042605 Bacteria 3632
4 Ga0466719_231157 3300042606 Bacteria 9568
5 Ga0466719_573480 3300042606 Bacteria 3955
6 Ga0466722_014905 3300042609 Unclassified 11902
7 Ga0466722_222967 3300042609 Bacteria 3777
8 Ga0466715_224279 3300042616 Bacteria 16535
9 Ga0466723_009818 3300042618 Bacteria 36345
10 Ga0466723_027465 3300042618 Bacteria 52841
11 Ga0466723_049253 3300042618 Bacteria 11224
12 Ga0466723_346350 3300042618 Bacteria 5810
13 Ga0466726_009284 3300042619 Bacteria 1406
14 Ga0466728_237298 3300042620 Bacteria 16295
15 Ga0466703_029820 3300042636 Bacteria 18253
16 Ga0466703_063089 3300042636 Bacteria 16476
17 Ga0466709_038183 3300042648 Bacteria 22972
18 Ga0466709_147845 3300042648 Bacteria 5553
19 Ga0466692_025648 3300042591 Bacteria 19659
20 Ga0466691_082016 3300042593 Bacteria 10945
21 Ga0466696_021207 3300042596 Bacteria 13892
22 Ga0466705_255015 3300042612 Unclassified 5184
23 Ga0466715_393597 3300042616 Bacteria 1611
24 Ga0466723_060220 3300042618 Bacteria 35228
25 Ga0466708_203261 3300042652 Bacteria 21519
26 Ga0466708_316762 3300042652 Bacteria 2561
27 Ga0466727_183461 3300042655 Bacteria 2012
28 Ga0466690_015048 3300042590 Bacteria 8534
29 Ga0466690_031932 3300042590 Unclassified 2760
30 AustNasuHG_c1025410 3300000089 Bacteria 1860
31 Ga0466705_279279 3300042612 Unclassified 1656
32 Ga0466722_119586 3300042609 Bacteria 1743
33 Ga0466712_046372 3300042614 Bacteria 8790
34 Ga0466715_032624 3300042616 Bacteria 23067
35 Ga0466715_234140 3300042616 Bacteria 25168
36 Ga0466715_392405 3300042616 Unclassified 3548
37 Ga0466726_150601 3300042619 Bacteria 2149
38 Ga0466726_365764 3300042619 Bacteria 1259
39 Ga0466704_048510 3300042643 Bacteria 6076
40 Ga0466704_454806 3300042643 Bacteria 6022
41 Ga0466709_097606 3300042648 Bacteria 9323
42 Ga0466709_098922 3300042648 Bacteria 7700
43 Ga0466709_350667 3300042648 Unclassified 2743
44 Ga0466727_092117 3300042655 Bacteria 2179
45 Ga0456237_0001071 3300041968 Bacteria 4328
46 Ga0466692_164851 3300042591 Bacteria 2287
47 Ga0466705_080304 3300042612 Bacteria 2189
48 Ga0466705_243168 3300042612 Bacteria 1830
49 Ga0466719_160604 3300042606 Bacteria 17127
50 Ga0466722_151885 3300042609 Bacteria 2904
51 Ga0466722_151922 3300042609 Bacteria 2351
52 Ga0466722_187212 3300042609 Bacteria 5632
53 Ga0466712_171275 3300042614 Unclassified 4870
54 Ga0466726_080045 3300042619 Bacteria 1023
55 Ga0466726_186926 3300042619 Bacteria 9408
56 Ga0466728_026267 3300042620 Archaea 2457
57 Ga0466703_032315 3300042636 Bacteria 5436
58 Ga0466704_132196 3300042643 Bacteria 7484
59 Ga0466704_188125 3300042643 Bacteria 10604
60 Ga0466708_128113 3300042652 Bacteria 3776
61 Ga0466691_011938 3300042593 Bacteria 24022
62 Ga0072941_1035775 3300005201 Bacteria 5873
63 Ga0466705_251379 3300042612 Bacteria 36395
64 Ga0466717_221951 3300042604 Bacteria 1080
65 Ga0466716_305295 3300042605 Bacteria 2314
66 Ga0466711_273145 3300042615 Bacteria 9301
67 Ga0466715_211457 3300042616 Bacteria 2733
68 Ga0466715_401146 3300042616 Unclassified 1286
69 Ga0466726_489033 3300042619 Bacteria 4380
70 Ga0466703_047992 3300042636 Bacteria 1880
71 Ga0466709_237136 3300042648 Bacteria 1656
72 Ga0456237_0005449 3300041968 Bacteria 2015
73 Ga0466696_338171 3300042596 Bacteria 2902
74 Ga0466705_314257 3300042612 Bacteria 7740
75 Ga0466722_000539 3300042609 Bacteria 3458
76 Ga0466722_081733 3300042609 Bacteria 1438
77 Ga0466715_575721 3300042616 Bacteria 22882
78 Ga0466726_239547 3300042619 Bacteria 6256
79 Ga0466704_111372 3300042643 Bacteria 52956
80 Ga0466704_159318 3300042643 Bacteria 3431
81 Ga0466708_010796 3300042652 Bacteria 2333
82 Ga0466708_360184 3300042652 Bacteria 1686
83 Ga0466708_446482 3300042652 Bacteria 7455
84 JGI24698J34947_10002463 3300002449 Unclassified 9985
85 JGI24702J35022_10025312 3300002462 Unclassified 3203
86 Ga0072941_1033071 3300005201 Bacteria 11202
87 Ga0466711_071729 3300042615 Bacteria 3659
88 Ga0466711_135785 3300042615 Bacteria 7395
89 Ga0466711_444837 3300042615 Bacteria 8611
90 Ga0466711_485838 3300042615 Bacteria 5739
91 Ga0466715_035427 3300042616 Bacteria 9302
92 Ga0466715_080809 3300042616 Bacteria 5084
93 Ga0466715_237147 3300042616 Bacteria 6253
94 Ga0466718_081719 3300042617 Bacteria 8245
95 Ga0466723_098339 3300042618 Bacteria 3770
96 Ga0466723_133916 3300042618 Bacteria 3160
97 Ga0466728_265042 3300042620 Bacteria 1539
98 Ga0466702_266881 3300042635 Bacteria 8583
99 Ga0466703_183935 3300042636 Bacteria 4959
100 Ga0466703_306512 3300042636 Bacteria 50589
101 Ga0466704_063935 3300042643 Bacteria 1260
102 Ga0466704_213780 3300042643 Bacteria 47213
103 Ga0466708_113190 3300042652 Bacteria 1388
104 Ga0466708_215717 3300042652 Bacteria 20469
105 Ga0466708_461683 3300042652 Bacteria 3543
106 Ga0466727_026276 3300042655 Bacteria 1003
107 Ga0466691_027813 3300042593 Unclassified 2157
108 Ga0466696_233241 3300042596 Bacteria 2064
109 Ga0466696_480154 3300042596 Unclassified 1860
110 Ga0072941_1028792 3300005201 Bacteria 8390
111 Ga0466719_498156 3300042606 Bacteria 69594
112 Ga0466722_026098 3300042609 Bacteria 2210
113 Ga0466722_197337 3300042609 Bacteria 13737
114 Ga0466705_395615 3300042612 Bacteria 4188
115 Ga0466711_108277 3300042615 Bacteria 1592
116 Ga0466715_268821 3300042616 Bacteria 14364
117 Ga0466728_097620 3300042620 Bacteria 5812
118 Ga0466703_161494 3300042636 Bacteria 16878
119 Ga0466709_323622 3300042648 Bacteria 2019
120 Ga0466708_349095 3300042652 Bacteria 1299
121 Ga0466690_103091 3300042590 Bacteria 10436
122 Ga0466691_213184 3300042593 Bacteria 5150
123 Ga0466694_201309 3300042594 Unclassified 3422
124 Ga0466696_015890 3300042596 Bacteria 1072
125 AustNasuHG_c1008717 3300000089 Bacteria 3589
126 JGI24698J34947_10033721 3300002449 Bacteria 2684

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1025410 AustNasuHG_10254102 237
2 3300042619 Ga0466726_186926 Ga0466726_186926_3854_4627 238
3 3300042636 Ga0466703_306512 Ga0466703_306512_13524_14312 238
4 3300042593 Ga0466691_213184 Ga0466691_213184_684_1472 239
5 3300000089 AustNasuHG_c1008717 AustNasuHG_10087173 241
6 3300042609 Ga0466722_014905 Ga0466722_014905_7457_8230 241
7 3300042652 Ga0466708_128113 Ga0466708_128113_1896_2675 241
8 3300042615 Ga0466711_444837 Ga0466711_444837_4973_5746 242
9 3300042615 Ga0466711_485838 Ga0466711_485838_1264_2052 242
10 3300042648 Ga0466709_038183 Ga0466709_038183_5828_6601 243
11 3300042652 Ga0466708_316762 Ga0466708_316762_1607_2398 243
12 3300042636 Ga0466703_029820 Ga0466703_029820_7156_7947 244
13 3300042652 Ga0466708_010796 Ga0466708_010796_282_1055 244
14 3300042655 Ga0466727_183461 Ga0466727_183461_586_1377 244
15 3300041968 Ga0456237_0001071 Ga0456237_0001071_1745_2482 245
16 3300042606 Ga0466719_498156 Ga0466719_498156_53450_54223 245
17 3300042617 Ga0466718_081719 Ga0466718_081719_6490_7299 245
18 3300041968 Ga0456237_0005449 Ga0456237_0005449_593_1375 247
19 3300042612 Ga0466705_279279 Ga0466705_279279_839_1612 247
20 3300042619 Ga0466726_150601 Ga0466726_150601_1262_2035 247
21 3300005201 Ga0072941_1028792 Ga0072941_10287925 248
22 3300042616 Ga0466715_080809 Ga0466715_080809_710_1489 248
23 3300042616 Ga0466715_575721 Ga0466715_575721_12229_13002 248
24 3300042636 Ga0466703_063089 Ga0466703_063089_9650_10435 248
25 3300042612 Ga0466705_255015 Ga0466705_255015_3157_3945 249
26 3300042643 Ga0466704_111372 Ga0466704_111372_46069_46857 249
27 3300010882 Ga0123354_10074745 Ga0123354_100747451 250
28 3300042614 Ga0466712_171275 Ga0466712_171275_2894_3667 250
29 3300002449 JGI24698J34947_10002463 JGI24698J34947_100024633 251
30 3300042590 Ga0466690_015048 Ga0466690_015048_4038_4817 251
31 3300042594 Ga0466694_201309 Ga0466694_201309_244_1014 251
32 3300042612 Ga0466705_395615 Ga0466705_395615_1723_2514 251
33 3300042648 Ga0466709_098922 Ga0466709_098922_1346_2131 251
34 3300002449 JGI24698J34947_10033721 JGI24698J34947_100337212 252
35 3300042596 Ga0466696_015890 Ga0466696_015890_183_1013 252
36 3300002462 JGI24702J35022_10025312 JGI24702J35022_100253124 253
37 3300042612 Ga0466705_314257 Ga0466705_314257_1613_2452 253
38 3300042606 Ga0466719_573480 Ga0466719_573480_1080_1916 254
39 3300042614 Ga0466712_046372 Ga0466712_046372_476_1285 254
40 3300042604 Ga0466717_221951 Ga0466717_221951_297_1067 256
41 3300042609 Ga0466722_081733 Ga0466722_081733_307_1077 256
42 3300042591 Ga0466692_025648 Ga0466692_025648_18603_19376 257
43 3300042593 Ga0466691_027813 Ga0466691_027813_283_1056 257
44 3300042593 Ga0466691_082016 Ga0466691_082016_8982_9755 257
45 3300042605 Ga0466716_081874 Ga0466716_081874_725_1498 257
46 3300042606 Ga0466719_160604 Ga0466719_160604_5719_6492 257
47 3300042606 Ga0466719_231157 Ga0466719_231157_3917_4690 257
48 3300042609 Ga0466722_000539 Ga0466722_000539_1482_2288 257
49 3300042609 Ga0466722_026098 Ga0466722_026098_1266_2039 257
50 3300042609 Ga0466722_119586 Ga0466722_119586_211_984 257
51 3300042609 Ga0466722_222967 Ga0466722_222967_2724_3497 257
52 3300042616 Ga0466715_224279 Ga0466715_224279_15124_15897 257
53 3300042616 Ga0466715_234140 Ga0466715_234140_1463_2236 257
54 3300042616 Ga0466715_268821 Ga0466715_268821_711_1484 257
55 3300042616 Ga0466715_392405 Ga0466715_392405_2400_3173 257
56 3300042616 Ga0466715_393597 Ga0466715_393597_671_1444 257
57 3300042618 Ga0466723_009818 Ga0466723_009818_27247_28020 257
58 3300042618 Ga0466723_027465 Ga0466723_027465_51468_52241 257
59 3300042619 Ga0466726_080045 Ga0466726_080045_182_955 257
60 3300042619 Ga0466726_489033 Ga0466726_489033_1919_2692 257
61 3300042620 Ga0466728_097620 Ga0466728_097620_4141_4914 257
62 3300042636 Ga0466703_047992 Ga0466703_047992_923_1696 257
63 3300042643 Ga0466704_063935 Ga0466704_063935_242_1015 257
64 3300042643 Ga0466704_159318 Ga0466704_159318_1488_2261 257
65 3300042648 Ga0466709_097606 Ga0466709_097606_4533_5324 257
66 3300042648 Ga0466709_237136 Ga0466709_237136_130_903 257
67 3300042648 Ga0466709_323622 Ga0466709_323622_806_1579 257
68 3300042648 Ga0466709_350667 Ga0466709_350667_1514_2287 257
69 3300042652 Ga0466708_113190 Ga0466708_113190_53_826 257
70 3300042652 Ga0466708_203261 Ga0466708_203261_8634_9407 257
71 3300042652 Ga0466708_215717 Ga0466708_215717_18418_19191 257
72 3300042652 Ga0466708_360184 Ga0466708_360184_823_1596 257
73 3300042652 Ga0466708_446482 Ga0466708_446482_451_1224 257
74 3300042652 Ga0466708_461683 Ga0466708_461683_1771_2544 257
75 iso_pr_bacteria 2781125697 2781443968 257
76 3300042596 Ga0466696_021207 Ga0466696_021207_8655_9434 259
77 3300042615 Ga0466711_135785 Ga0466711_135785_3873_4652 259
78 3300042620 Ga0466728_265042 Ga0466728_265042_565_1344 259
79 3300042643 Ga0466704_048510 Ga0466704_048510_2979_3794 259
80 3300042605 Ga0466716_305295 Ga0466716_305295_900_1682 260
81 3300042609 Ga0466722_187212 Ga0466722_187212_1074_1856 260
82 3300042616 Ga0466715_032624 Ga0466715_032624_20089_20871 260
83 3300005201 Ga0072941_1033071 Ga0072941_10330714 261
84 3300042618 Ga0466723_346350 Ga0466723_346350_125_910 261
85 3300042636 Ga0466703_183935 Ga0466703_183935_2996_3781 261
86 3300042596 Ga0466696_233241 Ga0466696_233241_1094_1882 262
87 3300042596 Ga0466696_338171 Ga0466696_338171_572_1360 262
88 3300042596 Ga0466696_480154 Ga0466696_480154_1030_1818 262
89 3300042605 Ga0466716_261930 Ga0466716_261930_691_1479 262
90 3300042612 Ga0466705_080304 Ga0466705_080304_862_1650 262
91 3300042615 Ga0466711_108277 Ga0466711_108277_491_1279 262
92 3300042615 Ga0466711_273145 Ga0466711_273145_6046_6834 262
93 3300042616 Ga0466715_211457 Ga0466715_211457_701_1489 262
94 3300042616 Ga0466715_237147 Ga0466715_237147_4466_5254 262
95 3300042619 Ga0466726_009284 Ga0466726_009284_501_1289 262
96 3300042636 Ga0466703_032315 Ga0466703_032315_2792_3580 262
97 3300042643 Ga0466704_454806 Ga0466704_454806_3142_3930 262
98 3300042652 Ga0466708_349095 Ga0466708_349095_116_904 262
99 3300042618 Ga0466723_098339 Ga0466723_098339_1449_2240 263
100 3300042635 Ga0466702_266881 Ga0466702_266881_4171_4965 264
101 3300042609 Ga0466722_151885 Ga0466722_151885_132_953 265
102 3300042620 Ga0466728_026267 Ga0466728_026267_237_1064 267
103 3300042609 Ga0466722_197337 Ga0466722_197337_4164_4970 268
104 3300042616 Ga0466715_401146 Ga0466715_401146_235_1044 269
105 3300042643 Ga0466704_188125 Ga0466704_188125_2933_3742 269
106 3300042593 Ga0466691_011938 Ga0466691_011938_18957_19772 271
107 3300042590 Ga0466690_031932 Ga0466690_031932_461_1279 272
108 3300042609 Ga0466722_151922 Ga0466722_151922_30_848 272
109 3300042612 Ga0466705_251379 Ga0466705_251379_23361_24179 272
110 3300042616 Ga0466715_035427 Ga0466715_035427_6640_7458 272
111 3300042618 Ga0466723_060220 Ga0466723_060220_12398_13216 272
112 3300042643 Ga0466704_213780 Ga0466704_213780_15115_15933 272
113 3300042648 Ga0466709_147845 Ga0466709_147845_2496_3314 272
114 3300005201 Ga0072941_1035775 Ga0072941_10357752 274
115 3300042618 Ga0466723_133916 Ga0466723_133916_1927_2751 274
116 3300042655 Ga0466727_026276 Ga0466727_026276_27_851 274
117 3300042619 Ga0466726_365764 Ga0466726_365764_240_1067 275
118 3300042655 Ga0466727_092117 Ga0466727_092117_154_981 275
119 3300042591 Ga0466692_164851 Ga0466692_164851_881_1741 276
120 3300042643 Ga0466704_132196 Ga0466704_132196_375_1214 279
121 3300042615 Ga0466711_071729 Ga0466711_071729_2697_3545 282
122 3300042619 Ga0466726_239547 Ga0466726_239547_383_1231 282
123 3300042612 Ga0466705_243168 Ga0466705_243168_334_1188 284
124 3300042620 Ga0466728_237298 Ga0466728_237298_12515_13465 286
125 3300042590 Ga0466690_103091 Ga0466690_103091_27_890 287
126 3300042636 Ga0466703_161494 Ga0466703_161494_8253_9143 296
127 3300042618 Ga0466723_049253 Ga0466723_049253_8051_8977 308

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.