Protein Family IF09138
Metagenome
Isolate
123
Members
31
Samples
120
Scaffolds
387.94
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_097458|Ga0466703_097458_11892_13277
- Length
- 461 aa
- Sequence
- VQLRIYSPGSLTAADLKVSPRQVAAQLANLFAGPRQPAVVANVFTGAGPADPPAVEKYPRWWYTRYEGVAVTKKTEIGTIAEKNRIVGSIASLIEKRDNFLLLGHKDPDTDCIASLVAFALLLSKFHREVTIYLAGPVAAHFSYLLAICKYNGISINYGKLSSVEPFQVLVILDTPKPDMIAANGEVQALLADKNLDKIEIDHHLETDSVYAGNSGCCLVSEASSTCELIGYLLLKLSRRAEYKKIDFFTRNLALAVLTGIVGDSQMGKYLKTHKERFFYRTFSEIFSRLLNEKTQKNSNNLSSMEAVFDTIQNFSVREKKCYDSIMSHKNTKHPVYYIYLDKKTSAEYFETWGAELVVNVSKGAADNLAEDSRKLGLVVYYDDPSLSEFIQFRLRRSADFVTIDLRKVLAELKIENGGGHPGAIGFRVKKDSVKSVKVYTEEIVQKICRLVEAAPAGEIH
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Unclassified
16.7%
Termitidae
16.7%
Termopsidae
10.0%
Rhinotermitidae
6.7%
Hodotermitidae
3.3%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_517256 | 3300042616 | Bacteria | 2739 |
| 2 | Ga0466692_033244 | 3300042591 | Bacteria | 5372 |
| 3 | Ga0466696_160729 | 3300042596 | Bacteria | 14370 |
| 4 | Ga0466696_189677 | 3300042596 | Bacteria | 5754 |
| 5 | Ga0072941_1025784 | 3300005201 | Bacteria | 2684 |
| 6 | Ga0466716_491583 | 3300042605 | Unclassified | 1120 |
| 7 | Ga0466719_312276 | 3300042606 | Bacteria | 11201 |
| 8 | Ga0466719_418774 | 3300042606 | Bacteria | 12954 |
| 9 | Ga0466722_033875 | 3300042609 | Bacteria | 18921 |
| 10 | Ga0466722_045656 | 3300042609 | Unclassified | 1759 |
| 11 | Ga0466735_053059 | 3300042624 | Bacteria | 1547 |
| 12 | Ga0466704_230373 | 3300042643 | Bacteria | 9925 |
| 13 | Ga0466704_232742 | 3300042643 | Bacteria | 17943 |
| 14 | Ga0466709_007384 | 3300042648 | Bacteria | 10100 |
| 15 | Ga0466727_030881 | 3300042655 | Bacteria | 4080 |
| 16 | Ga0466705_010709 | 3300042612 | Unclassified | 4486 |
| 17 | Ga0466705_291435 | 3300042612 | Bacteria | 4042 |
| 18 | Ga0466723_087343 | 3300042618 | Bacteria | 15969 |
| 19 | Ga0466723_287759 | 3300042618 | Bacteria | 52406 |
| 20 | Ga0466726_089180 | 3300042619 | Bacteria | 4118 |
| 21 | Ga0466728_152189 | 3300042620 | Bacteria | 11476 |
| 22 | Ga0466690_326159 | 3300042590 | Unclassified | 3026 |
| 23 | Ga0466719_027596 | 3300042606 | Bacteria | 4155 |
| 24 | Ga0466698_399979 | 3300042610 | Unclassified | 1443 |
| 25 | Ga0466703_314663 | 3300042636 | Bacteria | 6808 |
| 26 | Ga0466703_343302 | 3300042636 | Bacteria | 9051 |
| 27 | Ga0466704_131502 | 3300042643 | Bacteria | 4206 |
| 28 | Ga0466727_205944 | 3300042655 | Bacteria | 1373 |
| 29 | Ga0466705_222929 | 3300042612 | Bacteria | 8395 |
| 30 | Ga0466732_407353 | 3300042656 | Bacteria | 1911 |
| 31 | Ga0466715_236116 | 3300042616 | Bacteria | 4059 |
| 32 | Ga0466723_093698 | 3300042618 | Bacteria | 9431 |
| 33 | Ga0466723_097783 | 3300042618 | Bacteria | 3172 |
| 34 | Ga0466728_019369 | 3300042620 | Bacteria | 3417 |
| 35 | Ga0466690_010422 | 3300042590 | Bacteria | 3061 |
| 36 | Ga0466722_016453 | 3300042609 | Bacteria | 3789 |
| 37 | Ga0466703_333041 | 3300042636 | Unclassified | 4536 |
| 38 | Ga0466709_067107 | 3300042648 | Bacteria | 11678 |
| 39 | Ga0466709_170204 | 3300042648 | Bacteria | 7258 |
| 40 | Ga0466708_174855 | 3300042652 | Bacteria | 8316 |
| 41 | Ga0466727_206074 | 3300042655 | Bacteria | 2646 |
| 42 | Ga0466705_385361 | 3300042612 | Bacteria | 19595 |
| 43 | Ga0466715_240965 | 3300042616 | Bacteria | 3161 |
| 44 | Ga0466723_211701 | 3300042618 | Bacteria | 18280 |
| 45 | Ga0466726_256902 | 3300042619 | Unclassified | 1777 |
| 46 | Ga0466691_016412 | 3300042593 | Bacteria | 13994 |
| 47 | Ga0466695_136767 | 3300042595 | Bacteria | 4462 |
| 48 | Ga0466706_123612 | 3300042599 | Bacteria | 9764 |
| 49 | Ga0466706_237966 | 3300042599 | Bacteria | 1603 |
| 50 | Ga0466716_082382 | 3300042605 | Bacteria | 8099 |
| 51 | Ga0466716_464013 | 3300042605 | Unclassified | 1605 |
| 52 | Ga0466722_152377 | 3300042609 | Bacteria | 13126 |
| 53 | Ga0466722_250303 | 3300042609 | Bacteria | 17669 |
| 54 | Ga0466703_294761 | 3300042636 | Bacteria | 15505 |
| 55 | Ga0466704_546882 | 3300042643 | Bacteria | 10854 |
| 56 | Ga0466708_176588 | 3300042652 | Bacteria | 2832 |
| 57 | Ga0466727_283898 | 3300042655 | Bacteria | 2337 |
| 58 | Ga0466705_226605 | 3300042612 | Bacteria | 10193 |
| 59 | Ga0466705_343451 | 3300042612 | Bacteria | 8912 |
| 60 | Ga0466705_480306 | 3300042612 | Unclassified | 8997 |
| 61 | Ga0466715_165783 | 3300042616 | Bacteria | 28128 |
| 62 | Ga0466723_098131 | 3300042618 | Bacteria | 4481 |
| 63 | Ga0466723_135984 | 3300042618 | Bacteria | 10432 |
| 64 | Ga0466723_182417 | 3300042618 | Bacteria | 25448 |
| 65 | Ga0466690_307974 | 3300042590 | Bacteria | 8112 |
| 66 | Ga0466691_175417 | 3300042593 | Bacteria | 2534 |
| 67 | Ga0466696_066602 | 3300042596 | Bacteria | 19989 |
| 68 | Ga0466713_031678 | 3300042602 | Bacteria | 2112 |
| 69 | Ga0466719_185654 | 3300042606 | Unclassified | 3034 |
| 70 | Ga0466698_453199 | 3300042610 | Unclassified | 1717 |
| 71 | Ga0466703_229648 | 3300042636 | Bacteria | 13601 |
| 72 | Ga0466708_155238 | 3300042652 | Bacteria | 6234 |
| 73 | Ga0466715_042719 | 3300042616 | Bacteria | 6037 |
| 74 | Ga0466715_088087 | 3300042616 | Unclassified | 1710 |
| 75 | Ga0466723_053239 | 3300042618 | Bacteria | 13070 |
| 76 | Ga0466723_121895 | 3300042618 | Bacteria | 4293 |
| 77 | Ga0466726_194587 | 3300042619 | Bacteria | 2181 |
| 78 | Ga0466690_378249 | 3300042590 | Bacteria | 7201 |
| 79 | Ga0466692_200360 | 3300042591 | Bacteria | 35434 |
| 80 | Ga0466691_071431 | 3300042593 | Bacteria | 4122 |
| 81 | Ga0466696_048701 | 3300042596 | Bacteria | 3644 |
| 82 | Ga0123353_10105463 | 3300010167 | Bacteria | 4542 |
| 83 | AustNasuHG_c1008981 | 3300000089 | Bacteria | 3528 |
| 84 | Ga0072941_1009480 | 3300005201 | Bacteria | 18944 |
| 85 | Ga0466706_152380 | 3300042599 | Bacteria | 6486 |
| 86 | Ga0466716_095810 | 3300042605 | Bacteria | 5049 |
| 87 | Ga0466719_072444 | 3300042606 | Bacteria | 3261 |
| 88 | Ga0466708_250075 | 3300042652 | Bacteria | 27777 |
| 89 | Ga0466727_339153 | 3300042655 | Bacteria | 2542 |
| 90 | Ga0466711_196565 | 3300042615 | Bacteria | 18016 |
| 91 | Ga0466711_388720 | 3300042615 | Bacteria | 13691 |
| 92 | Ga0466715_017514 | 3300042616 | Bacteria | 2234 |
| 93 | Ga0466715_105456 | 3300042616 | Bacteria | 5625 |
| 94 | Ga0466728_037612 | 3300042620 | Bacteria | 3567 |
| 95 | Ga0466690_298012 | 3300042590 | Unclassified | 1682 |
| 96 | Ga0466692_082660 | 3300042591 | Bacteria | 9361 |
| 97 | Ga0466691_207539 | 3300042593 | Bacteria | 3673 |
| 98 | AustNasuHG_c1001259 | 3300000089 | Bacteria | 9126 |
| 99 | Ga0466716_157736 | 3300042605 | Bacteria | 9074 |
| 100 | Ga0466719_238642 | 3300042606 | Bacteria | 27025 |
| 101 | Ga0466703_097458 | 3300042636 | Bacteria | 17144 |
| 102 | Ga0466709_122814 | 3300042648 | Bacteria | 6741 |
| 103 | Ga0466709_172650 | 3300042648 | Bacteria | 3680 |
| 104 | Ga0466709_318800 | 3300042648 | Bacteria | 29404 |
| 105 | Ga0466709_403909 | 3300042648 | Bacteria | 2474 |
| 106 | Ga0466708_009550 | 3300042652 | Bacteria | 10521 |
| 107 | Ga0466708_412232 | 3300042652 | Bacteria | 5197 |
| 108 | Ga0466711_052848 | 3300042615 | Bacteria | 29761 |
| 109 | Ga0466723_083667 | 3300042618 | Bacteria | 2660 |
| 110 | Ga0466726_274166 | 3300042619 | Bacteria | 2682 |
| 111 | Ga0466726_356880 | 3300042619 | Bacteria | 5863 |
| 112 | Ga0466726_387162 | 3300042619 | Bacteria | 4172 |
| 113 | Ga0466707_159573 | 3300042601 | Unclassified | 1562 |
| 114 | Ga0466716_204400 | 3300042605 | Bacteria | 3919 |
| 115 | Ga0466716_277167 | 3300042605 | Unclassified | 2378 |
| 116 | Ga0466719_051165 | 3300042606 | Bacteria | 7836 |
| 117 | Ga0466722_194962 | 3300042609 | Bacteria | 18441 |
| 118 | Ga0466704_170315 | 3300042643 | Bacteria | 3151 |
| 119 | Ga0466709_409701 | 3300042648 | Bacteria | 3204 |
| 120 | Ga0466708_140383 | 3300042652 | Unclassified | 1618 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01368 | DHH | DHH family | 100 | 261 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.