Protein Family IF09098
Metagenome
Isolate
137
Members
37
Samples
136
Scaffolds
189.09
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_032543|Ga0466703_032543_2725_3357
- Length
- 210 aa
- Sequence
- MITAANGESVGESPGDDRLIIDQIVSGRKELFRILVQRYEQAVYGMGLSFFRNPEDAADFAQEVFLKSFRSLGGFQGRSRFSTWLYRIAYNTAVNSIRRQKDYRSLAGEGEPNCTGTGSDRPCSAGEGPDGETPERLLLRAVVTEAVREAMKDLPDRYRICVDLFFFYDRSYQEIEVITGYPVNTIKSHVFRAKKLLREKLEGIVEGGIE
Sample Types
Isolate
0.7%
Metagenome
99.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.9%
Termitidae
33.3%
Rhinotermitidae
11.1%
Unclassified
11.1%
Termopsidae
5.6%
Taxonomy
Archaea
3
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_140235 | 3300042659 | Bacteria | 3198 |
| 2 | Ga0466704_594303 | 3300042643 | Bacteria | 1825 |
| 3 | Ga0466708_222084 | 3300042652 | Bacteria | 10624 |
| 4 | Ga0123354_10445273 | 3300010882 | Bacteria | 1054 |
| 5 | Ga0466690_038007 | 3300042590 | Bacteria | 8234 |
| 6 | Ga0466691_004939 | 3300042593 | Bacteria | 14753 |
| 7 | Ga0466691_107178 | 3300042593 | Archaea | 3537 |
| 8 | Ga0466716_071678 | 3300042605 | Bacteria | 3399 |
| 9 | Ga0466722_013559 | 3300042609 | Bacteria | 8177 |
| 10 | Ga0466723_165141 | 3300042618 | Bacteria | 11652 |
| 11 | Ga0466728_220948 | 3300042620 | Bacteria | 1128 |
| 12 | JGI24702J35022_10048495 | 3300002462 | Bacteria | 2261 |
| 13 | Ga0466705_001314 | 3300042612 | Bacteria | 2745 |
| 14 | Ga0466703_258399 | 3300042636 | Bacteria | 6164 |
| 15 | Ga0466704_258537 | 3300042643 | Unclassified | 3196 |
| 16 | Ga0466708_171620 | 3300042652 | Bacteria | 4411 |
| 17 | Ga0466696_078034 | 3300042596 | Bacteria | 6320 |
| 18 | Ga0466713_014911 | 3300042602 | Bacteria | 1745 |
| 19 | Ga0466716_466340 | 3300042605 | Bacteria | 5165 |
| 20 | Ga0466716_520083 | 3300042605 | Bacteria | 2048 |
| 21 | Ga0466719_264055 | 3300042606 | Bacteria | 3344 |
| 22 | Ga0466720_160936 | 3300042607 | Bacteria | 1165 |
| 23 | Ga0466722_036236 | 3300042609 | Bacteria | 1765 |
| 24 | Ga0466722_097367 | 3300042609 | Bacteria | 7864 |
| 25 | Ga0466711_290877 | 3300042615 | Bacteria | 3263 |
| 26 | Ga0466715_084854 | 3300042616 | Bacteria | 9684 |
| 27 | Ga0466723_066824 | 3300042618 | Bacteria | 21336 |
| 28 | Ga0466723_077553 | 3300042618 | Bacteria | 2174 |
| 29 | Ga0466726_339261 | 3300042619 | Bacteria | 1277 |
| 30 | Ga0466705_280586 | 3300042612 | Bacteria | 2465 |
| 31 | Ga0466704_087352 | 3300042643 | Bacteria | 10850 |
| 32 | Ga0466708_109507 | 3300042652 | Bacteria | 14545 |
| 33 | Ga0466690_065689 | 3300042590 | Bacteria | 1875 |
| 34 | Ga0466691_174194 | 3300042593 | Bacteria | 17912 |
| 35 | Ga0466707_022255 | 3300042601 | Bacteria | 1180 |
| 36 | Ga0466713_116845 | 3300042602 | Bacteria | 2055 |
| 37 | Ga0466719_042673 | 3300042606 | Bacteria | 1138 |
| 38 | Ga0466719_338449 | 3300042606 | Bacteria | 1671 |
| 39 | Ga0466712_085121 | 3300042614 | Bacteria | 27516 |
| 40 | Ga0466715_051723 | 3300042616 | Bacteria | 23274 |
| 41 | Ga0466723_102548 | 3300042618 | Bacteria | 7793 |
| 42 | Ga0123357_10003698 | 3300009784 | Bacteria | 17661 |
| 43 | Ga0466705_234875 | 3300042612 | Bacteria | 2412 |
| 44 | Ga0466703_321449 | 3300042636 | Bacteria | 8517 |
| 45 | Ga0466704_101955 | 3300042643 | Bacteria | 19185 |
| 46 | Ga0466708_054774 | 3300042652 | Bacteria | 1460 |
| 47 | Ga0466708_061104 | 3300042652 | Bacteria | 4085 |
| 48 | Ga0466727_317334 | 3300042655 | Bacteria | 1111 |
| 49 | Ga0466727_340976 | 3300042655 | Bacteria | 3672 |
| 50 | Ga0123353_10652944 | 3300010167 | Bacteria | 1489 |
| 51 | Ga0264413_131816 | 3300024493 | Unclassified | 4053 |
| 52 | Ga0466707_149534 | 3300042601 | Bacteria | 10899 |
| 53 | Ga0466707_194458 | 3300042601 | Bacteria | 3490 |
| 54 | Ga0466713_057438 | 3300042602 | Bacteria | 3695 |
| 55 | Ga0466715_503963 | 3300042616 | Bacteria | 1027 |
| 56 | Ga0466723_030088 | 3300042618 | Bacteria | 17138 |
| 57 | Ga0466726_023985 | 3300042619 | Bacteria | 3841 |
| 58 | Ga0466728_381486 | 3300042620 | Bacteria | 3418 |
| 59 | Ga0466705_151234 | 3300042612 | Bacteria | 11067 |
| 60 | Ga0466703_421496 | 3300042636 | Bacteria | 1698 |
| 61 | Ga0466704_333543 | 3300042643 | Unclassified | 5169 |
| 62 | Ga0466704_407088 | 3300042643 | Bacteria | 4385 |
| 63 | Ga0466690_335828 | 3300042590 | Bacteria | 1711 |
| 64 | Ga0466696_112558 | 3300042596 | Bacteria | 9851 |
| 65 | Ga0466696_217530 | 3300042596 | Bacteria | 3174 |
| 66 | Ga0466698_298763 | 3300042610 | Bacteria | 1092 |
| 67 | Ga0466711_239123 | 3300042615 | Bacteria | 43474 |
| 68 | Ga0466726_412698 | 3300042619 | Bacteria | 1494 |
| 69 | Ga0466728_021526 | 3300042620 | Bacteria | 1994 |
| 70 | Ga0466728_086606 | 3300042620 | Bacteria | 5310 |
| 71 | AustNasuHG_c1021888 | 3300000089 | Bacteria | 2062 |
| 72 | JGI24702J35022_10032219 | 3300002462 | Bacteria | 2807 |
| 73 | JGI24702J35022_10148264 | 3300002462 | Bacteria | 1314 |
| 74 | Ga0068305_10103761 | 3300005083 | Bacteria | 2321 |
| 75 | Ga0466705_294788 | 3300042612 | Bacteria | 2700 |
| 76 | Ga0466703_031949 | 3300042636 | Bacteria | 1211 |
| 77 | Ga0466703_090561 | 3300042636 | Bacteria | 6070 |
| 78 | Ga0466703_131097 | 3300042636 | Unclassified | 4839 |
| 79 | Ga0466709_230975 | 3300042648 | Bacteria | 9399 |
| 80 | Ga0466708_406848 | 3300042652 | Bacteria | 1745 |
| 81 | Ga0456237_0005053 | 3300041968 | Bacteria | 2102 |
| 82 | Ga0466691_023884 | 3300042593 | Bacteria | 1260 |
| 83 | Ga0466696_068328 | 3300042596 | Bacteria | 1465 |
| 84 | Ga0466696_392883 | 3300042596 | Bacteria | 1201 |
| 85 | Ga0466696_427787 | 3300042596 | Bacteria | 2878 |
| 86 | Ga0466707_120455 | 3300042601 | Bacteria | 2036 |
| 87 | Ga0466716_043338 | 3300042605 | Bacteria | 4509 |
| 88 | Ga0466716_050077 | 3300042605 | Bacteria | 2257 |
| 89 | Ga0466719_010450 | 3300042606 | Bacteria | 11674 |
| 90 | Ga0466719_196642 | 3300042606 | Unclassified | 3269 |
| 91 | Ga0466715_065034 | 3300042616 | Bacteria | 3956 |
| 92 | Ga0466723_082414 | 3300042618 | Bacteria | 1317 |
| 93 | Ga0466723_099185 | 3300042618 | Bacteria | 2393 |
| 94 | Ga0466723_131066 | 3300042618 | Bacteria | 51139 |
| 95 | Ga0466723_312728 | 3300042618 | Bacteria | 7559 |
| 96 | Ga0466723_372204 | 3300042618 | Bacteria | 4177 |
| 97 | Ga0466728_019113 | 3300042620 | Bacteria | 8245 |
| 98 | Ga0466728_146813 | 3300042620 | Bacteria | 2527 |
| 99 | Ga0466728_382716 | 3300042620 | Bacteria | 10504 |
| 100 | Ga0466705_122133 | 3300042612 | Archaea | 2254 |
| 101 | Ga0466705_129228 | 3300042612 | Bacteria | 3623 |
| 102 | Ga0466705_342239 | 3300042612 | Bacteria | 5235 |
| 103 | Ga0466729_264251 | 3300042621 | Bacteria | 2319 |
| 104 | Ga0466703_019072 | 3300042636 | Bacteria | 12598 |
| 105 | Ga0466703_032543 | 3300042636 | Bacteria | 6037 |
| 106 | Ga0466703_182193 | 3300042636 | Bacteria | 10010 |
| 107 | Ga0466704_101595 | 3300042643 | Bacteria | 7586 |
| 108 | Ga0466704_149466 | 3300042643 | Bacteria | 1111 |
| 109 | Ga0466709_378468 | 3300042648 | Bacteria | 1316 |
| 110 | Ga0466708_362708 | 3300042652 | Bacteria | 8584 |
| 111 | Ga0264413_104924 | 3300024493 | Bacteria | 11606 |
| 112 | Ga0466690_077273 | 3300042590 | Bacteria | 1341 |
| 113 | Ga0466690_081547 | 3300042590 | Unclassified | 2441 |
| 114 | Ga0466692_074656 | 3300042591 | Bacteria | 32125 |
| 115 | Ga0466691_078332 | 3300042593 | Bacteria | 2955 |
| 116 | Ga0466691_190091 | 3300042593 | Bacteria | 2318 |
| 117 | Ga0466696_128349 | 3300042596 | Bacteria | 2157 |
| 118 | Ga0466696_307108 | 3300042596 | Bacteria | 6354 |
| 119 | Ga0466707_202449 | 3300042601 | Bacteria | 1543 |
| 120 | Ga0466719_547594 | 3300042606 | Bacteria | 1682 |
| 121 | Ga0466705_444462 | 3300042612 | Bacteria | 11898 |
| 122 | Ga0466726_165920 | 3300042619 | Bacteria | 4443 |
| 123 | Ga0466728_156707 | 3300042620 | Archaea | 2784 |
| 124 | Ga0466705_196160 | 3300042612 | Unclassified | 1850 |
| 125 | Ga0466703_225893 | 3300042636 | Bacteria | 1360 |
| 126 | Ga0466703_307082 | 3300042636 | Bacteria | 1314 |
| 127 | Ga0466704_054634 | 3300042643 | Bacteria | 3515 |
| 128 | Ga0415639_013250 | 3300038395 | Bacteria | 6660 |
| 129 | Ga0466691_104767 | 3300042593 | Bacteria | 6773 |
| 130 | Ga0466707_279383 | 3300042601 | Bacteria | 1010 |
| 131 | Ga0466720_020914 | 3300042607 | Bacteria | 6167 |
| 132 | Ga0466718_160637 | 3300042617 | Bacteria | 1238 |
| 133 | Ga0466723_069359 | 3300042618 | Bacteria | 6092 |
| 134 | Ga0466723_202879 | 3300042618 | Bacteria | 6014 |
| 135 | JGI24698J34947_10024804 | 3300002449 | Bacteria | 3197 |
| 136 | JGI24702J35022_10222396 | 3300002462 | Bacteria | 1088 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.