Protein Family IF09079

Metagenome Isolate
162 Members
45 Samples
146 Scaffolds
487.5 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_007688|Ga0466703_007688_837_2498
Length
553 aa
Sequence
MNKILKEKIMEAFSSVLPITAIVLIVSVVLVPMPAGTILMFLVGAALLIIGMGFFTLGADMAMMPMGEGIGVQLTRSSNLFLVLFVSFVMGLIITIAEPDLQVLARQVPSVPSMVLIITVGAGVGLFLLISVLRILLKIRLSALLVIFYLGVFILACLPVTSSSFIPVAFDSGGVTTGPITVPFILAMGIGVASIRSDKNSQDDSFGLIALCSIGPILAVLILGAFFNPDSAAVESHTVPVVASSREVVQAFTRELPEYAKEVLLAMGAIVLFFLVFQLITKRFKKHQLARMAVGFIYTFIGLVFFLTGVSVGFIPVGHLVGSELAASSFKWILVPLGMIIGYFIVAAEPAVHVLNKQVEEISSGAITAKLMNRGLSVGMAIALAITMIRILTGISLLWILIPGYTFALFLTFFVPPIFTGVAFDSGGVCSGPMTSTFLLPLAMGTCEGAGGNLMTDAFGIVAMVAMTPLIIIQLMGVLFVHRAKKAALVQAVEQAERISGITKEEAEAITEFADIPGNYETDFSAASAVREGTDMTLINKEMPSEGKEPSNG

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 31.8%
Kalotermitidae 31.8%
Termitidae 11.4%
Unclassified 6.8%
Rhinotermitidae 6.8%
Termopsidae 6.8%
Blaberidae 2.3%
Passalidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
2 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
3 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 2772190975 Treponema sp. RmG30 Isolate Blaberidae
8 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
9 650716102 Treponema primitia ZAS-2 Isolate Unclassified
10 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
11 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
12 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
13 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
14 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
15 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
21 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
35 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
36 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_007953 3300042612 Bacteria 6103
2 Ga0466711_011963 3300042615 Bacteria 11744
3 Ga0466711_092868 3300042615 Bacteria 5466
4 Ga0466723_023544 3300042618 Bacteria 21695
5 Ga0466723_073780 3300042618 Bacteria 7547
6 Ga0466723_303097 3300042618 Bacteria 8192
7 Ga0466723_359305 3300042618 Bacteria 32167
8 Ga0466728_178757 3300042620 Bacteria 6061
9 Ga0466728_383002 3300042620 Bacteria 5438
10 Ga0466690_133887 3300042590 Bacteria 2197
11 Ga0466696_105614 3300042596 Bacteria 4190
12 Ga0466696_147665 3300042596 Bacteria 4125
13 Ga0466735_056321 3300042624 Bacteria 3945
14 Ga0466735_218288 3300042624 Bacteria 1587
15 Ga0466709_310581 3300042648 Bacteria 13889
16 Ga0466727_175956 3300042655 Bacteria 3572
17 Ga0466727_274766 3300042655 Bacteria 3766
18 Ga0466705_044170 3300042612 Bacteria 9389
19 Ga0466705_082797 3300042612 Bacteria 13500
20 Ga0466711_024293 3300042615 Bacteria 2378
21 Ga0466711_341599 3300042615 Bacteria 30993
22 Ga0466715_002177 3300042616 Bacteria 2879
23 Ga0466723_358005 3300042618 Bacteria 10827
24 Ga0466726_060655 3300042619 Bacteria 3036
25 Ga0466726_182377 3300042619 Bacteria 1649
26 Ga0466729_125602 3300042621 Bacteria 5010
27 Ga0466690_230675 3300042590 Bacteria 12493
28 Ga0466707_114761 3300042601 Bacteria 2034
29 Ga0466713_133878 3300042602 Unclassified 3813
30 Ga0466716_210549 3300042605 Bacteria 15132
31 Ga0466716_298696 3300042605 Bacteria 2098
32 Ga0466719_134180 3300042606 Bacteria 2246
33 Ga0466719_543334 3300042606 Unclassified 9314
34 Ga0466735_048613 3300042624 Bacteria 3032
35 Ga0466703_049444 3300042636 Bacteria 6048
36 Ga0466703_381872 3300042636 Bacteria 12519
37 Ga0466704_055119 3300042643 Unclassified 3313
38 Ga0466704_235687 3300042643 Bacteria 94333
39 Ga0466709_016027 3300042648 Bacteria 7234
40 Ga0466709_164449 3300042648 Bacteria 8247
41 Ga0466709_218646 3300042648 Bacteria 3428
42 Ga0466727_308800 3300042655 Bacteria 1572
43 Ga0466727_336788 3300042655 Bacteria 2613
44 Ga0466705_003041 3300042612 Bacteria 14560
45 Ga0466705_159156 3300042612 Bacteria 6274
46 Ga0466705_491135 3300042612 Bacteria 2926
47 Ga0466715_355198 3300042616 Bacteria 4280
48 Ga0466726_251625 3300042619 Bacteria 2214
49 Ga0466728_090859 3300042620 Bacteria 3131
50 Ga0466728_355117 3300042620 Bacteria 8121
51 AustNasuHG_c1000901 3300000089 Bacteria 10724
52 JGI24702J35022_10016381 3300002462 Bacteria 4063
53 Ga0466691_042306 3300042593 Bacteria 12800
54 Ga0466716_130183 3300042605 Bacteria 21500
55 Ga0466722_252056 3300042609 Bacteria 5714
56 Ga0466703_043354 3300042636 Bacteria 4111
57 Ga0466709_379280 3300042648 Bacteria 4282
58 Ga0466708_046682 3300042652 Bacteria 25817
59 Ga0466705_033200 3300042612 Bacteria 12778
60 Ga0466705_199681 3300042612 Bacteria 3478
61 Ga0466705_218358 3300042612 Bacteria 8829
62 Ga0466711_097729 3300042615 Bacteria 8108
63 Ga0466715_407106 3300042616 Bacteria 11966
64 Ga0466723_337213 3300042618 Bacteria 2524
65 Ga0466728_208461 3300042620 Bacteria 2577
66 JGI24702J35022_10038080 3300002462 Bacteria 2567
67 Ga0466691_017747 3300042593 Bacteria 9335
68 Ga0466691_052486 3300042593 Bacteria 28400
69 Ga0466696_086151 3300042596 Bacteria 9966
70 Ga0466719_286242 3300042606 Bacteria 14418
71 Ga0466703_007688 3300042636 Bacteria 23124
72 Ga0466704_615696 3300042643 Bacteria 10094
73 Ga0466709_236782 3300042648 Bacteria 6193
74 Ga0466708_427818 3300042652 Bacteria 41992
75 Ga0466727_284023 3300042655 Bacteria 10103
76 Ga0466705_072243 3300042612 Bacteria 5934
77 Ga0466705_238128 3300042612 Bacteria 14245
78 Ga0466715_077254 3300042616 Bacteria 24143
79 Ga0466715_580172 3300042616 Bacteria 2887
80 Ga0466726_440508 3300042619 Bacteria 11362
81 Ga0466728_026520 3300042620 Bacteria 18025
82 Ga0466728_269904 3300042620 Bacteria 6681
83 Ga0466691_105196 3300042593 Unclassified 9390
84 Ga0466696_083034 3300042596 Bacteria 1992
85 Ga0466696_092289 3300042596 Bacteria 12876
86 Ga0466716_113126 3300042605 Bacteria 2015
87 Ga0466735_008483 3300042624 Bacteria 4143
88 Ga0466703_059325 3300042636 Bacteria 9671
89 Ga0466709_150700 3300042648 Bacteria 2143
90 Ga0466708_144805 3300042652 Bacteria 3365
91 Ga0466705_026481 3300042612 Bacteria 6896
92 Ga0466705_514040 3300042612 Bacteria 10928
93 Ga0466715_147642 3300042616 Bacteria 7327
94 Ga0466715_458288 3300042616 Bacteria 5638
95 Ga0466723_000917 3300042618 Bacteria 1935
96 Ga0466723_063603 3300042618 Unclassified 8915
97 Ga0466723_164847 3300042618 Bacteria 38657
98 Ga0466726_261291 3300042619 Bacteria 2972
99 Ga0466728_140758 3300042620 Bacteria 4052
100 Ga0466728_165867 3300042620 Bacteria 8063
101 Ga0466728_240624 3300042620 Bacteria 12770
102 Ga0072940_1008788 3300005200 Bacteria 12159
103 Ga0466692_066433 3300042591 Bacteria 43794
104 Ga0466691_008752 3300042593 Bacteria 4710
105 Ga0466719_430816 3300042606 Bacteria 25582
106 Ga0466703_008942 3300042636 Bacteria 4501
107 Ga0466704_523828 3300042643 Unclassified 1788
108 Ga0466708_076209 3300042652 Unclassified 5867
109 Ga0466727_336158 3300042655 Bacteria 2168
110 Ga0466705_197407 3300042612 Bacteria 15274
111 Ga0466711_070350 3300042615 Bacteria 2942
112 Ga0466711_484750 3300042615 Bacteria 31730
113 Ga0466715_146553 3300042616 Bacteria 21620
114 Ga0466715_199822 3300042616 Bacteria 9044
115 Ga0466718_147364 3300042617 Bacteria 21998
116 Ga0466723_005344 3300042618 Bacteria 11560
117 Ga0466723_054494 3300042618 Bacteria 10416
118 Ga0466723_073684 3300042618 Unclassified 9025
119 Ga0466726_033587 3300042619 Bacteria 7253
120 Ga0466728_111301 3300042620 Bacteria 3970
121 IMNBL1DRAFT_c0001724 3300000062 Bacteria 16057
122 Ga0466690_199716 3300042590 Bacteria 9185
123 Ga0466692_044411 3300042591 Bacteria 37141
124 Ga0466691_070657 3300042593 Bacteria 6074
125 Ga0466694_121698 3300042594 Bacteria 9072
126 Ga0466707_230050 3300042601 Bacteria 2006
127 Ga0466716_169690 3300042605 Bacteria 13745
128 Ga0466719_261345 3300042606 Bacteria 15808
129 Ga0466735_152832 3300042624 Bacteria 8576
130 Ga0466703_099000 3300042636 Bacteria 2211
131 Ga0466704_063937 3300042643 Bacteria 21423
132 Ga0466708_238944 3300042652 Bacteria 3959
133 Ga0466723_305384 3300042618 Bacteria 3834
134 Ga0466726_112274 3300042619 Bacteria 1808
135 Ga0466728_456091 3300042620 Bacteria 2789
136 Ga0466729_128797 3300042621 Bacteria 2425
137 Ga0072941_1011982 3300005201 Bacteria 17576
138 Ga0466690_231972 3300042590 Bacteria 3370
139 Ga0466690_368532 3300042590 Bacteria 5556
140 Ga0466691_065323 3300042593 Bacteria 8951
141 Ga0466719_057724 3300042606 Bacteria 7308
142 Ga0466735_007341 3300042624 Bacteria 1996
143 Ga0466704_395243 3300042643 Bacteria 3941
144 Ga0466704_564678 3300042643 Bacteria 3869
145 Ga0466709_361519 3300042648 Bacteria 14108
146 Ga0466727_088130 3300042655 Bacteria 2085

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07556 DUF1538 Protein of unknown function (DUF1538) 270 479 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.