Protein Family IF08828
Metagenome
Isolate
252
Members
48
Samples
249
Scaffolds
107.37
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_168918|Ga0466735_168918_9124_9495
- Length
- 123 aa
- Sequence
- MDKLLAGQNLRNALGRNIKLFRFHRKLSQADLAEKANISITFLSDIERGNKWPYPETLTSLAKALNIAVYELFKLESDISNDVKDRMTRFSDDILRILNQSILSVRRQYLHELDEKEGSGQED
Sample Types
Isolate
1.2%
Metagenome
98.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
30.4%
Unclassified
13.0%
Rhinotermitidae
8.7%
Termopsidae
6.5%
Taxonomy
Archaea
2
Bacteria
214
Eukaryota
0
Viruses
2
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 16 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_439392 | 3300042656 | Bacteria | 1612 |
| 2 | Ga0123357_10348924 | 3300009784 | Bacteria | 1419 |
| 3 | Ga0123353_13126748 | 3300010167 | Unclassified | 532 |
| 4 | Ga0466715_245497 | 3300042616 | Bacteria | 4998 |
| 5 | Ga0466715_331107 | 3300042616 | Bacteria | 1088 |
| 6 | Ga0466723_017604 | 3300042618 | Bacteria | 13525 |
| 7 | Ga0466723_019171 | 3300042618 | Unclassified | 1840 |
| 8 | Ga0466726_179564 | 3300042619 | Unclassified | 1033 |
| 9 | Ga0466728_279869 | 3300042620 | Bacteria | 16701 |
| 10 | Ga0466728_356644 | 3300042620 | Bacteria | 3325 |
| 11 | JGI24705J35276_12222702 | 3300002504 | Archaea | 2444 |
| 12 | Ga0072941_1000180 | 3300005201 | Bacteria | 54954 |
| 13 | Ga0466707_105807 | 3300042601 | Bacteria | 2711 |
| 14 | Ga0466707_187002 | 3300042601 | Bacteria | 1791 |
| 15 | Ga0466716_145607 | 3300042605 | Unclassified | 2331 |
| 16 | Ga0466698_476313 | 3300042610 | Bacteria | 5358 |
| 17 | Ga0466735_064462 | 3300042624 | Bacteria | 3327 |
| 18 | Ga0466703_045927 | 3300042636 | Bacteria | 6797 |
| 19 | Ga0466708_057562 | 3300042652 | Bacteria | 3247 |
| 20 | Ga0466727_009586 | 3300042655 | Bacteria | 1378 |
| 21 | Ga0466727_173863 | 3300042655 | Bacteria | 1401 |
| 22 | Ga0466692_087581 | 3300042591 | Unclassified | 8679 |
| 23 | Ga0466692_180695 | 3300042591 | Bacteria | 1666 |
| 24 | Ga0466691_111717 | 3300042593 | Bacteria | 7108 |
| 25 | Ga0466691_123277 | 3300042593 | Bacteria | 16326 |
| 26 | Ga0466696_259870 | 3300042596 | Bacteria | 2778 |
| 27 | Ga0466705_231255 | 3300042612 | Bacteria | 9343 |
| 28 | Ga0466732_145373 | 3300042656 | Bacteria | 15408 |
| 29 | Ga0466723_019600 | 3300042618 | Bacteria | 13548 |
| 30 | Ga0466726_043041 | 3300042619 | Unclassified | 4156 |
| 31 | Ga0466726_173362 | 3300042619 | Bacteria | 11617 |
| 32 | Ga0466726_184970 | 3300042619 | Unclassified | 2118 |
| 33 | Ga0466726_352638 | 3300042619 | Bacteria | 1641 |
| 34 | JGI24698J34947_10052755 | 3300002449 | Bacteria | 2039 |
| 35 | JGI24695J34938_10003896 | 3300002450 | Bacteria | 10105 |
| 36 | JGI24695J34938_10377282 | 3300002450 | Bacteria | 628 |
| 37 | Ga0072940_1021294 | 3300005200 | Bacteria | 1772 |
| 38 | Ga0072940_1144156 | 3300005200 | Bacteria | 2173 |
| 39 | Ga0466700_081931 | 3300042600 | Bacteria | 1798 |
| 40 | Ga0466707_233864 | 3300042601 | Bacteria | 1075 |
| 41 | Ga0466719_027886 | 3300042606 | Bacteria | 1820 |
| 42 | Ga0466719_350610 | 3300042606 | Bacteria | 1341 |
| 43 | Ga0466720_190743 | 3300042607 | Bacteria | 1283 |
| 44 | Ga0466703_099574 | 3300042636 | Bacteria | 4543 |
| 45 | Ga0466704_065975 | 3300042643 | Unclassified | 1786 |
| 46 | Ga0466704_124982 | 3300042643 | Bacteria | 3730 |
| 47 | Ga0466704_351260 | 3300042643 | Bacteria | 2244 |
| 48 | Ga0466709_027107 | 3300042648 | Bacteria | 28864 |
| 49 | Ga0466709_203440 | 3300042648 | Bacteria | 3845 |
| 50 | Ga0466708_108956 | 3300042652 | Bacteria | 3239 |
| 51 | Ga0466708_148573 | 3300042652 | Bacteria | 3189 |
| 52 | Ga0466708_157332 | 3300042652 | Unclassified | 4054 |
| 53 | Ga0466708_204793 | 3300042652 | Bacteria | 6167 |
| 54 | Ga0466708_353791 | 3300042652 | Unclassified | 1870 |
| 55 | Ga0466727_164948 | 3300042655 | Bacteria | 2245 |
| 56 | Ga0456237_0015223 | 3300041968 | Bacteria | 1091 |
| 57 | Ga0466690_433142 | 3300042590 | Bacteria | 1842 |
| 58 | Ga0466692_077206 | 3300042591 | Bacteria | 1055 |
| 59 | Ga0123356_10002408 | 3300010049 | Bacteria | 20023 |
| 60 | Ga0466705_494056 | 3300042612 | Bacteria | 1602 |
| 61 | Ga0466712_063760 | 3300042614 | Bacteria | 23040 |
| 62 | Ga0466718_094685 | 3300042617 | Bacteria | 21732 |
| 63 | Ga0466718_131137 | 3300042617 | Bacteria | 6084 |
| 64 | Ga0466718_152714 | 3300042617 | Unclassified | 1705 |
| 65 | Ga0466723_167225 | 3300042618 | Bacteria | 1384 |
| 66 | Ga0466726_209004 | 3300042619 | Unclassified | 1431 |
| 67 | Ga0466726_352718 | 3300042619 | Bacteria | 7976 |
| 68 | Ga0466726_444183 | 3300042619 | Bacteria | 1206 |
| 69 | Ga0466729_127963 | 3300042621 | Bacteria | 1418 |
| 70 | JGI24698J34947_10055115 | 3300002449 | Bacteria | 1982 |
| 71 | JGI24695J34938_10170655 | 3300002450 | Bacteria | 897 |
| 72 | Ga0466707_139955 | 3300042601 | Bacteria | 1547 |
| 73 | Ga0466719_158056 | 3300042606 | Unclassified | 2335 |
| 74 | Ga0466720_134858 | 3300042607 | Bacteria | 2138 |
| 75 | Ga0466722_033192 | 3300042609 | Bacteria | 1489 |
| 76 | Ga0466722_068529 | 3300042609 | Bacteria | 8612 |
| 77 | Ga0466722_123240 | 3300042609 | Unclassified | 1317 |
| 78 | Ga0466735_130917 | 3300042624 | Bacteria | 2914 |
| 79 | Ga0466735_168918 | 3300042624 | Bacteria | 23518 |
| 80 | Ga0466704_083528 | 3300042643 | Bacteria | 16023 |
| 81 | Ga0466709_068418 | 3300042648 | Bacteria | 1800 |
| 82 | Ga0466708_052342 | 3300042652 | Bacteria | 2246 |
| 83 | Ga0466727_026644 | 3300042655 | Bacteria | 2519 |
| 84 | Ga0264413_110019 | 3300024493 | Bacteria | 2333 |
| 85 | Ga0466690_024977 | 3300042590 | Bacteria | 1305 |
| 86 | Ga0466690_047302 | 3300042590 | Bacteria | 10255 |
| 87 | Ga0466690_126067 | 3300042590 | Bacteria | 1694 |
| 88 | Ga0466690_276257 | 3300042590 | Bacteria | 1650 |
| 89 | Ga0466692_002204 | 3300042591 | Bacteria | 1574 |
| 90 | Ga0466705_065712 | 3300042612 | Bacteria | 1935 |
| 91 | Ga0466705_168708 | 3300042612 | Bacteria | 15467 |
| 92 | Ga0466705_310338 | 3300042612 | Bacteria | 1822 |
| 93 | Ga0466732_220202 | 3300042656 | Bacteria | 16700 |
| 94 | Ga0123354_10382436 | 3300010882 | Unclassified | 1213 |
| 95 | Ga0466705_517018 | 3300042612 | Bacteria | 1587 |
| 96 | Ga0466712_019948 | 3300042614 | Bacteria | 6059 |
| 97 | Ga0466712_205258 | 3300042614 | Bacteria | 2468 |
| 98 | Ga0466711_176199 | 3300042615 | Bacteria | 2981 |
| 99 | Ga0466718_057552 | 3300042617 | Bacteria | 3176 |
| 100 | Ga0466718_098154 | 3300042617 | Viruses | 1111 |
| 101 | Ga0466726_025680 | 3300042619 | Bacteria | 1964 |
| 102 | Ga0466726_073588 | 3300042619 | Bacteria | 1041 |
| 103 | Ga0466729_013202 | 3300042621 | Bacteria | 3172 |
| 104 | Ga0466729_104598 | 3300042621 | Bacteria | 2353 |
| 105 | AustNasuHG_c1008101 | 3300000089 | Bacteria | 3724 |
| 106 | JGI24698J34947_10044349 | 3300002449 | Bacteria | 2277 |
| 107 | JGI24698J34947_10092256 | 3300002449 | Bacteria | 1385 |
| 108 | JGI24698J34947_10157998 | 3300002449 | Bacteria | 933 |
| 109 | Ga0072940_1016175 | 3300005200 | Bacteria | 2796 |
| 110 | Ga0072941_1013106 | 3300005201 | Bacteria | 11456 |
| 111 | Ga0466707_305076 | 3300042601 | Bacteria | 1432 |
| 112 | Ga0466719_117987 | 3300042606 | Bacteria | 5008 |
| 113 | Ga0466720_022388 | 3300042607 | Unclassified | 7008 |
| 114 | Ga0466704_010554 | 3300042643 | Bacteria | 1389 |
| 115 | Ga0466704_236978 | 3300042643 | Archaea | 4686 |
| 116 | Ga0466704_603926 | 3300042643 | Unclassified | 1378 |
| 117 | Ga0466708_119445 | 3300042652 | Bacteria | 4791 |
| 118 | Ga0466708_246218 | 3300042652 | Bacteria | 12061 |
| 119 | Ga0466708_302955 | 3300042652 | Bacteria | 1672 |
| 120 | Ga0466690_254419 | 3300042590 | Unclassified | 1853 |
| 121 | Ga0466692_140909 | 3300042591 | Unclassified | 7974 |
| 122 | Ga0466694_100170 | 3300042594 | Bacteria | 6200 |
| 123 | Ga0466705_350366 | 3300042612 | Bacteria | 2560 |
| 124 | Ga0466732_042167 | 3300042656 | Bacteria | 6617 |
| 125 | Ga0466732_053410 | 3300042656 | Bacteria | 2421 |
| 126 | Ga0466732_082237 | 3300042656 | Bacteria | 1996 |
| 127 | Ga0466732_317381 | 3300042656 | Unclassified | 1260 |
| 128 | Ga0123357_10395956 | 3300009784 | Unclassified | 1263 |
| 129 | Ga0123356_10001619 | 3300010049 | Bacteria | 24675 |
| 130 | Ga0123353_10719511 | 3300010167 | Bacteria | 1397 |
| 131 | Ga0123353_11633530 | 3300010167 | Unclassified | 812 |
| 132 | Ga0466705_512127 | 3300042612 | Viruses | 2524 |
| 133 | Ga0466715_059768 | 3300042616 | Bacteria | 8103 |
| 134 | Ga0466715_292443 | 3300042616 | Bacteria | 10833 |
| 135 | Ga0466718_101509 | 3300042617 | Bacteria | 1027 |
| 136 | Ga0466723_168411 | 3300042618 | Bacteria | 2721 |
| 137 | Ga0466726_026940 | 3300042619 | Unclassified | 1226 |
| 138 | Ga0466726_424489 | 3300042619 | Bacteria | 1413 |
| 139 | Ga0466728_205371 | 3300042620 | Bacteria | 1075 |
| 140 | AustNasuHG_c1000835 | 3300000089 | Bacteria | 11057 |
| 141 | AustNasuHG_c1017659 | 3300000089 | Bacteria | 2369 |
| 142 | JGI24698J34947_10124735 | 3300002449 | Unclassified | 1111 |
| 143 | Ga0466707_240169 | 3300042601 | Bacteria | 1192 |
| 144 | Ga0466707_330809 | 3300042601 | Bacteria | 2152 |
| 145 | Ga0466713_067186 | 3300042602 | Bacteria | 3629 |
| 146 | Ga0466716_384801 | 3300042605 | Bacteria | 2297 |
| 147 | Ga0466722_031721 | 3300042609 | Bacteria | 8449 |
| 148 | Ga0466722_072991 | 3300042609 | Bacteria | 1249 |
| 149 | Ga0466722_178571 | 3300042609 | Bacteria | 1169 |
| 150 | Ga0466722_217363 | 3300042609 | Bacteria | 5217 |
| 151 | Ga0466698_447285 | 3300042610 | Bacteria | 1615 |
| 152 | Ga0466708_024159 | 3300042652 | Bacteria | 2703 |
| 153 | Ga0466708_083140 | 3300042652 | Bacteria | 34789 |
| 154 | Ga0466727_268534 | 3300042655 | Bacteria | 1078 |
| 155 | Ga0264413_125428 | 3300024493 | Bacteria | 4987 |
| 156 | Ga0466690_124714 | 3300042590 | Bacteria | 1759 |
| 157 | Ga0466692_125052 | 3300042591 | Bacteria | 28079 |
| 158 | Ga0466692_167975 | 3300042591 | Bacteria | 1565 |
| 159 | Ga0466693_141172 | 3300042592 | Bacteria | 1920 |
| 160 | Ga0466699_174177 | 3300042597 | Unclassified | 2007 |
| 161 | Ga0466705_006921 | 3300042612 | Bacteria | 5438 |
| 162 | Ga0123353_10259940 | 3300010167 | Bacteria | 2682 |
| 163 | Ga0466712_073666 | 3300042614 | Bacteria | 11455 |
| 164 | Ga0466718_078123 | 3300042617 | Bacteria | 2373 |
| 165 | Ga0466726_436536 | 3300042619 | Bacteria | 1273 |
| 166 | Ga0466728_152558 | 3300042620 | Bacteria | 1568 |
| 167 | JGI24695J34938_10009511 | 3300002450 | Bacteria | 5401 |
| 168 | JGI24695J34938_10017299 | 3300002450 | Bacteria | 3637 |
| 169 | Ga0466707_074345 | 3300042601 | Bacteria | 4644 |
| 170 | Ga0466707_275889 | 3300042601 | Bacteria | 1654 |
| 171 | Ga0466707_350516 | 3300042601 | Bacteria | 1310 |
| 172 | Ga0466707_363747 | 3300042601 | Bacteria | 2646 |
| 173 | Ga0466713_023434 | 3300042602 | Bacteria | 1221 |
| 174 | Ga0466716_089585 | 3300042605 | Bacteria | 4756 |
| 175 | Ga0466720_238721 | 3300042607 | Bacteria | 1189 |
| 176 | Ga0466722_175602 | 3300042609 | Bacteria | 3099 |
| 177 | Ga0466722_232101 | 3300042609 | Bacteria | 18690 |
| 178 | Ga0466698_061237 | 3300042610 | Bacteria | 7817 |
| 179 | Ga0466698_083691 | 3300042610 | Bacteria | 9542 |
| 180 | Ga0466703_128320 | 3300042636 | Bacteria | 3034 |
| 181 | Ga0466703_319929 | 3300042636 | Bacteria | 2601 |
| 182 | Ga0466704_029592 | 3300042643 | Bacteria | 10731 |
| 183 | Ga0466708_049919 | 3300042652 | Bacteria | 1303 |
| 184 | Ga0466708_294781 | 3300042652 | Bacteria | 4233 |
| 185 | Ga0466727_027654 | 3300042655 | Bacteria | 1233 |
| 186 | Ga0466727_338109 | 3300042655 | Bacteria | 1424 |
| 187 | Ga0415639_101269 | 3300038395 | Bacteria | 3733 |
| 188 | Ga0466692_026237 | 3300042591 | Bacteria | 7365 |
| 189 | Ga0466692_114102 | 3300042591 | Bacteria | 14151 |
| 190 | Ga0466692_161676 | 3300042591 | Bacteria | 1014 |
| 191 | Ga0466691_047023 | 3300042593 | Unclassified | 2289 |
| 192 | Ga0466696_056658 | 3300042596 | Bacteria | 2779 |
| 193 | Ga0466699_297399 | 3300042597 | Bacteria | 1534 |
| 194 | Ga0123356_10001354 | 3300010049 | Bacteria | 27067 |
| 195 | Ga0123356_10091798 | 3300010049 | Bacteria | 2895 |
| 196 | Ga0123356_11355125 | 3300010049 | Bacteria | 873 |
| 197 | Ga0466712_006363 | 3300042614 | Bacteria | 15076 |
| 198 | Ga0466711_301683 | 3300042615 | Unclassified | 1758 |
| 199 | Ga0466715_020709 | 3300042616 | Bacteria | 7699 |
| 200 | Ga0466715_102672 | 3300042616 | Bacteria | 5033 |
| 201 | Ga0466715_183081 | 3300042616 | Bacteria | 6050 |
| 202 | Ga0466715_420314 | 3300042616 | Bacteria | 1865 |
| 203 | Ga0466728_086686 | 3300042620 | Bacteria | 1310 |
| 204 | Ga0466728_407909 | 3300042620 | Bacteria | 2826 |
| 205 | Ga0466729_083448 | 3300042621 | Bacteria | 1172 |
| 206 | JGI24698J34947_10059068 | 3300002449 | Bacteria | 1897 |
| 207 | JGI24698J34947_10124932 | 3300002449 | Bacteria | 1110 |
| 208 | JGI24695J34938_10144606 | 3300002450 | Bacteria | 972 |
| 209 | Ga0068305_10933988 | 3300005083 | Bacteria | 523 |
| 210 | Ga0466716_165033 | 3300042605 | Bacteria | 5131 |
| 211 | Ga0466719_529194 | 3300042606 | Bacteria | 3542 |
| 212 | Ga0466698_040977 | 3300042610 | Bacteria | 1383 |
| 213 | Ga0466735_099317 | 3300042624 | Bacteria | 1220 |
| 214 | Ga0466703_234378 | 3300042636 | Unclassified | 5582 |
| 215 | Ga0466703_243136 | 3300042636 | Unclassified | 1560 |
| 216 | Ga0466704_025694 | 3300042643 | Bacteria | 11309 |
| 217 | Ga0466704_058805 | 3300042643 | Bacteria | 5252 |
| 218 | Ga0466704_221899 | 3300042643 | Bacteria | 2753 |
| 219 | Ga0466709_293528 | 3300042648 | Bacteria | 1302 |
| 220 | Ga0466709_294431 | 3300042648 | Bacteria | 58398 |
| 221 | Ga0466727_102584 | 3300042655 | Unclassified | 1432 |
| 222 | Ga0264413_124978 | 3300024493 | Bacteria | 1399 |
| 223 | Ga0264413_130716 | 3300024493 | Bacteria | 2623 |
| 224 | Ga0466690_212329 | 3300042590 | Bacteria | 1926 |
| 225 | Ga0466692_142661 | 3300042591 | Bacteria | 5222 |
| 226 | Ga0466691_089147 | 3300042593 | Bacteria | 5057 |
| 227 | Ga0466696_440395 | 3300042596 | Bacteria | 1221 |
| 228 | Ga0466699_420380 | 3300042597 | Bacteria | 1008 |
| 229 | Ga0123356_10103636 | 3300010049 | Bacteria | 2733 |
| 230 | Ga0123353_10011003 | 3300010167 | Bacteria | 12697 |
| 231 | Ga0466712_198527 | 3300042614 | Bacteria | 3939 |
| 232 | Ga0466711_284040 | 3300042615 | Unclassified | 1387 |
| 233 | Ga0466718_043714 | 3300042617 | Bacteria | 2012 |
| 234 | Ga0466718_116482 | 3300042617 | Bacteria | 5503 |
| 235 | Ga0466726_099615 | 3300042619 | Unclassified | 1258 |
| 236 | Ga0466728_029479 | 3300042620 | Bacteria | 16859 |
| 237 | Ga0466728_208570 | 3300042620 | Bacteria | 4901 |
| 238 | AustNasuHG_c1084472 | 3300000089 | Bacteria | 526 |
| 239 | JGI24695J34938_10000300 | 3300002450 | Bacteria | 48880 |
| 240 | Ga0072940_1050288 | 3300005200 | Bacteria | 2749 |
| 241 | Ga0466707_044171 | 3300042601 | Bacteria | 4027 |
| 242 | Ga0466707_246320 | 3300042601 | Unclassified | 1002 |
| 243 | Ga0466720_051673 | 3300042607 | Unclassified | 5355 |
| 244 | Ga0466735_032246 | 3300042624 | Bacteria | 2048 |
| 245 | Ga0466735_211701 | 3300042624 | Bacteria | 1852 |
| 246 | Ga0466709_290540 | 3300042648 | Bacteria | 15902 |
| 247 | Ga0466727_196089 | 3300042655 | Bacteria | 20518 |
| 248 | Ga0466727_279572 | 3300042655 | Bacteria | 1629 |
| 249 | Ga0466691_224682 | 3300042593 | Bacteria | 1076 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.