Protein Family IF08770
Metagenome
Isolate
142
Members
48
Samples
136
Scaffolds
119.65
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_074091|Ga0466735_074091_1307_1771
- Length
- 154 aa
- Sequence
- VNNTVNTFVSGRAGEDKAAAYLENAGLSIIARNFRGRGGEIDLIALEGGTNPADLGAKPAAWPMEGLQGENSRLCPAGAAPQTLVFVEVKSWTAMDFENLEYSINAKKQKKIIETAKFFLQKHREYSEAAVRFDVVFVNADTITHLASAFTESV
Sample Types
Isolate
4.2%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Kalotermitidae
28.9%
Unclassified
15.6%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 31 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 32 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 33 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 34 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 46 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 47 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10006086 | 3300010049 | Bacteria | 12239 |
| 2 | FAAS_10088326 | 3300001880 | Unclassified | 525 |
| 3 | JGI24698J34947_10012209 | 3300002449 | Bacteria | 4713 |
| 4 | JGI24698J34947_10175031 | 3300002449 | Bacteria | 864 |
| 5 | JGI24695J34938_10018038 | 3300002450 | Bacteria | 3541 |
| 6 | Ga0466722_234855 | 3300042609 | Bacteria | 2653 |
| 7 | Ga0466735_115960 | 3300042624 | Bacteria | 1450 |
| 8 | Ga0466704_207376 | 3300042643 | Bacteria | 2432 |
| 9 | Ga0264413_100652 | 3300024493 | Bacteria | 12802 |
| 10 | Ga0466690_064813 | 3300042590 | Unclassified | 1304 |
| 11 | Ga0466694_088603 | 3300042594 | Bacteria | 1480 |
| 12 | Ga0466711_155221 | 3300042615 | Bacteria | 8949 |
| 13 | Ga0466715_180236 | 3300042616 | Bacteria | 2766 |
| 14 | Ga0466723_359907 | 3300042618 | Bacteria | 8863 |
| 15 | Ga0466729_039116 | 3300042621 | Bacteria | 2270 |
| 16 | Ga0123356_11081855 | 3300010049 | Bacteria | 970 |
| 17 | Ga0123353_10468982 | 3300010167 | Bacteria | 1847 |
| 18 | Nasutiter_Contig33744 | 2030936001 | Bacteria | 797 |
| 19 | AustNasuHG_c1016443 | 3300000089 | Bacteria | 2476 |
| 20 | JGI24695J34938_10002625 | 3300002450 | Bacteria | 13482 |
| 21 | JGI24695J34938_10014986 | 3300002450 | Bacteria | 3994 |
| 22 | JGI24695J34938_10043091 | 3300002450 | Bacteria | 2016 |
| 23 | Ga0074263_117735 | 3300005485 | Unclassified | 1331 |
| 24 | Ga0466719_360113 | 3300042606 | Bacteria | 8804 |
| 25 | Ga0466731_296550 | 3300042622 | Bacteria | 2833 |
| 26 | Ga0466735_074091 | 3300042624 | Bacteria | 3273 |
| 27 | Ga0466708_173165 | 3300042652 | Bacteria | 2781 |
| 28 | Ga0466695_336155 | 3300042595 | Bacteria | 1143 |
| 29 | Ga0466699_308427 | 3300042597 | Bacteria | 1537 |
| 30 | Ga0466715_078708 | 3300042616 | Bacteria | 1581 |
| 31 | Ga0466715_535173 | 3300042616 | Bacteria | 1847 |
| 32 | Ga0466715_570575 | 3300042616 | Bacteria | 20092 |
| 33 | Ga0466718_098621 | 3300042617 | Bacteria | 5798 |
| 34 | Ga0466718_141229 | 3300042617 | Bacteria | 7489 |
| 35 | Ga0466726_360395 | 3300042619 | Bacteria | 1262 |
| 36 | Ga0466726_374632 | 3300042619 | Bacteria | 1172 |
| 37 | Ga0466732_000091 | 3300042656 | Bacteria | 1231 |
| 38 | Ga0466732_050189 | 3300042656 | Bacteria | 1140 |
| 39 | Ga0123356_10029459 | 3300010049 | Bacteria | 5142 |
| 40 | Ga0123353_12209867 | 3300010167 | Bacteria | 665 |
| 41 | JGI24698J34947_10021051 | 3300002449 | Unclassified | 3511 |
| 42 | JGI24698J34947_10053609 | 3300002449 | Bacteria | 2017 |
| 43 | JGI24698J34947_10113997 | 3300002449 | Bacteria | 1187 |
| 44 | Ga0466700_152021 | 3300042600 | Bacteria | 1146 |
| 45 | Ga0466700_463977 | 3300042600 | Bacteria | 1071 |
| 46 | Ga0466719_092183 | 3300042606 | Bacteria | 1121 |
| 47 | Ga0466722_200896 | 3300042609 | Bacteria | 2190 |
| 48 | Ga0264413_100851 | 3300024493 | Bacteria | 32165 |
| 49 | Ga0466692_097979 | 3300042591 | Bacteria | 1863 |
| 50 | Ga0466694_224383 | 3300042594 | Bacteria | 2862 |
| 51 | Ga0466705_418385 | 3300042612 | Bacteria | 2930 |
| 52 | Ga0466712_041481 | 3300042614 | Bacteria | 1514 |
| 53 | Ga0466712_091082 | 3300042614 | Bacteria | 11658 |
| 54 | Ga0466711_034373 | 3300042615 | Bacteria | 3644 |
| 55 | Ga0466715_249734 | 3300042616 | Bacteria | 10546 |
| 56 | Ga0466718_132789 | 3300042617 | Bacteria | 1066 |
| 57 | Ga0466723_116277 | 3300042618 | Bacteria | 4356 |
| 58 | Ga0466726_202483 | 3300042619 | Bacteria | 3431 |
| 59 | Ga0123356_10003302 | 3300010049 | Bacteria | 16941 |
| 60 | JGI24698J34947_10088558 | 3300002449 | Bacteria | 1428 |
| 61 | JGI24695J34938_10016431 | 3300002450 | Bacteria | 3762 |
| 62 | JGI24695J34938_10310788 | 3300002450 | Bacteria | 683 |
| 63 | Ga0466719_119853 | 3300042606 | Bacteria | 1388 |
| 64 | Ga0466692_047602 | 3300042591 | Bacteria | 7497 |
| 65 | Ga0466694_062678 | 3300042594 | Bacteria | 8128 |
| 66 | Ga0466696_115284 | 3300042596 | Bacteria | 1303 |
| 67 | Ga0466699_226234 | 3300042597 | Bacteria | 7640 |
| 68 | Ga0466712_126095 | 3300042614 | Unclassified | 2068 |
| 69 | Ga0123356_10007399 | 3300010049 | Bacteria | 10954 |
| 70 | Ga0123356_10833732 | 3300010049 | Bacteria | 1093 |
| 71 | JGI24702J35022_10072280 | 3300002462 | Bacteria | 1859 |
| 72 | JGI24699J35502_10710821 | 3300002509 | Bacteria | 776 |
| 73 | Ga0466700_168716 | 3300042600 | Bacteria | 2213 |
| 74 | Ga0466707_037278 | 3300042601 | Unclassified | 1902 |
| 75 | Ga0466707_150106 | 3300042601 | Bacteria | 10020 |
| 76 | Ga0466719_241307 | 3300042606 | Bacteria | 1571 |
| 77 | Ga0466698_028651 | 3300042610 | Bacteria | 1289 |
| 78 | Ga0466731_037643 | 3300042622 | Bacteria | 4919 |
| 79 | Ga0466735_212847 | 3300042624 | Unclassified | 1748 |
| 80 | Ga0466702_097735 | 3300042635 | Bacteria | 1710 |
| 81 | Ga0466704_194953 | 3300042643 | Bacteria | 8389 |
| 82 | Ga0466727_061817 | 3300042655 | Bacteria | 1819 |
| 83 | Ga0466690_329174 | 3300042590 | Bacteria | 1812 |
| 84 | Ga0466694_145020 | 3300042594 | Bacteria | 3621 |
| 85 | Ga0466699_435625 | 3300042597 | Bacteria | 2083 |
| 86 | Ga0466705_005290 | 3300042612 | Bacteria | 9700 |
| 87 | Ga0123356_13868175 | 3300010049 | Bacteria | 517 |
| 88 | AustNasuHG_c1004629 | 3300000089 | Bacteria | 4935 |
| 89 | JGI24698J34947_10004302 | 3300002449 | Bacteria | 7750 |
| 90 | JGI24698J34947_10005795 | 3300002449 | Bacteria | 6774 |
| 91 | JGI24698J34947_10008914 | 3300002449 | Bacteria | 5504 |
| 92 | Ga0072941_1010743 | 3300005201 | Bacteria | 35389 |
| 93 | Ga0466707_026094 | 3300042601 | Bacteria | 2952 |
| 94 | Ga0466735_169789 | 3300042624 | Bacteria | 1173 |
| 95 | Ga0466708_298225 | 3300042652 | Bacteria | 10265 |
| 96 | Ga0466727_306705 | 3300042655 | Bacteria | 2310 |
| 97 | Ga0466691_086166 | 3300042593 | Bacteria | 11074 |
| 98 | Ga0466694_187344 | 3300042594 | Bacteria | 1041 |
| 99 | Ga0466694_387489 | 3300042594 | Bacteria | 1621 |
| 100 | Ga0466699_355914 | 3300042597 | Bacteria | 3363 |
| 101 | Ga0466712_000910 | 3300042614 | Bacteria | 3525 |
| 102 | Ga0466712_277036 | 3300042614 | Bacteria | 1169 |
| 103 | Ga0466715_394762 | 3300042616 | Bacteria | 38358 |
| 104 | Ga0466726_415755 | 3300042619 | Bacteria | 3444 |
| 105 | Ga0466728_446391 | 3300042620 | Bacteria | 4297 |
| 106 | Ga0466705_291225 | 3300042612 | Bacteria | 1702 |
| 107 | Ga0123356_11216628 | 3300010049 | Bacteria | 919 |
| 108 | AustNasuHG_c1010063 | 3300000089 | Bacteria | 3306 |
| 109 | JGI24695J34938_10005039 | 3300002450 | Bacteria | 8403 |
| 110 | Ga0466700_123812 | 3300042600 | Bacteria | 11955 |
| 111 | Ga0466707_359198 | 3300042601 | Bacteria | 6073 |
| 112 | Ga0466719_199961 | 3300042606 | Bacteria | 1546 |
| 113 | Ga0466709_146817 | 3300042648 | Bacteria | 30075 |
| 114 | Ga0466691_000739 | 3300042593 | Bacteria | 3503 |
| 115 | Ga0466694_172049 | 3300042594 | Bacteria | 13742 |
| 116 | Ga0466694_317366 | 3300042594 | Bacteria | 2236 |
| 117 | Ga0466694_395397 | 3300042594 | Bacteria | 1696 |
| 118 | Ga0466711_277432 | 3300042615 | Bacteria | 2505 |
| 119 | Ga0466711_364049 | 3300042615 | Bacteria | 29051 |
| 120 | Ga0466711_372158 | 3300042615 | Bacteria | 3702 |
| 121 | Ga0466715_476792 | 3300042616 | Bacteria | 2357 |
| 122 | Ga0466705_044690 | 3300042612 | Bacteria | 24374 |
| 123 | Ga0123356_10556816 | 3300010049 | Bacteria | 1308 |
| 124 | Ga0123356_12238745 | 3300010049 | Bacteria | 683 |
| 125 | Ga0466700_059335 | 3300042600 | Bacteria | 1899 |
| 126 | Ga0466735_190046 | 3300042624 | Bacteria | 1744 |
| 127 | Ga0466703_228698 | 3300042636 | Bacteria | 3799 |
| 128 | Ga0466709_114667 | 3300042648 | Bacteria | 3223 |
| 129 | Ga0466708_227918 | 3300042652 | Bacteria | 3321 |
| 130 | Ga0466708_283359 | 3300042652 | Unclassified | 1100 |
| 131 | Ga0466727_159864 | 3300042655 | Bacteria | 1198 |
| 132 | Ga0466690_432981 | 3300042590 | Bacteria | 6571 |
| 133 | Ga0466699_062943 | 3300042597 | Bacteria | 1981 |
| 134 | Ga0466712_207059 | 3300042614 | Bacteria | 1789 |
| 135 | Ga0466715_072097 | 3300042616 | Bacteria | 1882 |
| 136 | Ga0466726_029762 | 3300042619 | Bacteria | 2905 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02021 | UPF0102 | Uncharacterised protein family UPF0102 | 14 | 138 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.