Protein Family IF08759
Metagenome
Isolate
117
Members
25
Samples
115
Scaffolds
132.21
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_067282|Ga0466735_067282_95_490
- Length
- 119 aa
- Sequence
- MHPKLRRFSDTLDALFREVDDKLEDVYGGLFPLPDMDGLFEVMPDFSTGIGSEMGRGYIVSFRVATLERVPEDQFEAFMEAAAELIREGLPVFFPGRALDCVRDGKRFKIIGDFSLGEA
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
56.0%
Rhinotermitidae
16.0%
Unclassified
12.0%
Termopsidae
12.0%
Blaberidae
4.0%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 3 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 23 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_184844 | 3300042593 | Bacteria | 3502 |
| 2 | Ga0466711_035532 | 3300042615 | Bacteria | 3855 |
| 3 | Ga0466715_162035 | 3300042616 | Bacteria | 3127 |
| 4 | Ga0466723_199695 | 3300042618 | Bacteria | 6512 |
| 5 | Ga0466726_340808 | 3300042619 | Bacteria | 2123 |
| 6 | Ga0466716_146850 | 3300042605 | Bacteria | 18294 |
| 7 | Ga0466716_288098 | 3300042605 | Bacteria | 2044 |
| 8 | Ga0466722_051387 | 3300042609 | Bacteria | 13665 |
| 9 | Ga0466703_003259 | 3300042636 | Bacteria | 3623 |
| 10 | Ga0466703_073204 | 3300042636 | Bacteria | 15294 |
| 11 | Ga0466708_052925 | 3300042652 | Bacteria | 30385 |
| 12 | Ga0466708_369965 | 3300042652 | Bacteria | 10199 |
| 13 | Ga0466727_094670 | 3300042655 | Bacteria | 1838 |
| 14 | Ga0466705_161612 | 3300042612 | Bacteria | 3317 |
| 15 | Ga0466690_127146 | 3300042590 | Bacteria | 1332 |
| 16 | Ga0466691_109259 | 3300042593 | Bacteria | 3021 |
| 17 | Ga0466696_316898 | 3300042596 | Bacteria | 7485 |
| 18 | Ga0466711_010362 | 3300042615 | Bacteria | 22130 |
| 19 | Ga0466711_352525 | 3300042615 | Bacteria | 66792 |
| 20 | Ga0466715_023591 | 3300042616 | Bacteria | 27228 |
| 21 | Ga0466715_241901 | 3300042616 | Unclassified | 5007 |
| 22 | Ga0466715_620455 | 3300042616 | Bacteria | 5918 |
| 23 | Ga0466728_455063 | 3300042620 | Bacteria | 2287 |
| 24 | Ga0466719_100535 | 3300042606 | Bacteria | 4279 |
| 25 | Ga0466722_096386 | 3300042609 | Bacteria | 12957 |
| 26 | Ga0466709_379623 | 3300042648 | Bacteria | 8204 |
| 27 | Ga0466705_050316 | 3300042612 | Bacteria | 19211 |
| 28 | Ga0466705_160938 | 3300042612 | Bacteria | 6688 |
| 29 | Ga0466690_173822 | 3300042590 | Bacteria | 2246 |
| 30 | Ga0466691_013346 | 3300042593 | Bacteria | 2767 |
| 31 | Ga0466711_157869 | 3300042615 | Bacteria | 9210 |
| 32 | Ga0466715_151208 | 3300042616 | Bacteria | 11848 |
| 33 | Ga0466723_078634 | 3300042618 | Bacteria | 13876 |
| 34 | Ga0466716_125154 | 3300042605 | Bacteria | 7635 |
| 35 | Ga0466719_469598 | 3300042606 | Bacteria | 1964 |
| 36 | Ga0466735_009658 | 3300042624 | Bacteria | 3450 |
| 37 | Ga0466703_242181 | 3300042636 | Bacteria | 5380 |
| 38 | Ga0466705_212732 | 3300042612 | Bacteria | 7612 |
| 39 | Ga0466705_272298 | 3300042612 | Bacteria | 6588 |
| 40 | Ga0466692_195552 | 3300042591 | Bacteria | 21808 |
| 41 | Ga0466715_160983 | 3300042616 | Bacteria | 1484 |
| 42 | Ga0466715_381258 | 3300042616 | Bacteria | 2221 |
| 43 | Ga0466715_390638 | 3300042616 | Bacteria | 27328 |
| 44 | Ga0466723_003999 | 3300042618 | Unclassified | 1878 |
| 45 | Ga0466723_061644 | 3300042618 | Bacteria | 3369 |
| 46 | Ga0466713_127443 | 3300042602 | Bacteria | 1053 |
| 47 | Ga0466703_229967 | 3300042636 | Bacteria | 1847 |
| 48 | Ga0466704_254495 | 3300042643 | Bacteria | 1563 |
| 49 | Ga0466704_345261 | 3300042643 | Bacteria | 4375 |
| 50 | Ga0466709_375151 | 3300042648 | Bacteria | 3728 |
| 51 | Ga0466727_180974 | 3300042655 | Bacteria | 4196 |
| 52 | Ga0466727_258940 | 3300042655 | Unclassified | 1145 |
| 53 | Ga0466727_340160 | 3300042655 | Bacteria | 3558 |
| 54 | Ga0466690_042932 | 3300042590 | Bacteria | 7531 |
| 55 | Ga0466690_197792 | 3300042590 | Unclassified | 1605 |
| 56 | Ga0466690_263738 | 3300042590 | Bacteria | 1397 |
| 57 | Ga0466691_132382 | 3300042593 | Bacteria | 3633 |
| 58 | Ga0466711_440489 | 3300042615 | Bacteria | 3132 |
| 59 | Ga0466715_001179 | 3300042616 | Bacteria | 3169 |
| 60 | Ga0466723_329234 | 3300042618 | Bacteria | 1466 |
| 61 | Ga0466716_126354 | 3300042605 | Bacteria | 2921 |
| 62 | Ga0466722_063458 | 3300042609 | Bacteria | 1104 |
| 63 | Ga0466704_158536 | 3300042643 | Unclassified | 3316 |
| 64 | Ga0466704_363080 | 3300042643 | Bacteria | 3779 |
| 65 | Ga0466709_122149 | 3300042648 | Bacteria | 10528 |
| 66 | Ga0466708_196100 | 3300042652 | Bacteria | 1649 |
| 67 | Ga0466727_126141 | 3300042655 | Bacteria | 12622 |
| 68 | Ga0466727_154561 | 3300042655 | Bacteria | 1053 |
| 69 | Ga0456237_0044256 | 3300041968 | Unclassified | 585 |
| 70 | Ga0466692_076950 | 3300042591 | Unclassified | 1656 |
| 71 | Ga0466692_181397 | 3300042591 | Bacteria | 2415 |
| 72 | Ga0466715_341321 | 3300042616 | Bacteria | 6250 |
| 73 | Ga0466726_274499 | 3300042619 | Bacteria | 2312 |
| 74 | Ga0466726_474314 | 3300042619 | Bacteria | 2238 |
| 75 | Ga0466728_474723 | 3300042620 | Unclassified | 1090 |
| 76 | Ga0466716_347117 | 3300042605 | Bacteria | 2346 |
| 77 | Ga0466719_078857 | 3300042606 | Bacteria | 24547 |
| 78 | Ga0466722_214715 | 3300042609 | Bacteria | 7804 |
| 79 | Ga0466703_007078 | 3300042636 | Bacteria | 1924 |
| 80 | Ga0466709_307510 | 3300042648 | Unclassified | 1901 |
| 81 | Ga0466709_350176 | 3300042648 | Bacteria | 1839 |
| 82 | Ga0466708_042520 | 3300042652 | Bacteria | 6752 |
| 83 | Ga0466727_074733 | 3300042655 | Bacteria | 2170 |
| 84 | Ga0466705_243928 | 3300042612 | Bacteria | 2814 |
| 85 | Ga0466690_213867 | 3300042590 | Bacteria | 1636 |
| 86 | Ga0466692_093451 | 3300042591 | Bacteria | 8024 |
| 87 | Ga0466691_122424 | 3300042593 | Bacteria | 14627 |
| 88 | Ga0466715_201006 | 3300042616 | Bacteria | 2485 |
| 89 | Ga0466723_247492 | 3300042618 | Bacteria | 31507 |
| 90 | Ga0466726_046538 | 3300042619 | Bacteria | 2243 |
| 91 | Ga0466707_307343 | 3300042601 | Bacteria | 1421 |
| 92 | Ga0466719_149712 | 3300042606 | Bacteria | 5531 |
| 93 | Ga0466719_512310 | 3300042606 | Unclassified | 1125 |
| 94 | Ga0466722_180837 | 3300042609 | Bacteria | 11935 |
| 95 | Ga0466735_067282 | 3300042624 | Bacteria | 1221 |
| 96 | Ga0466703_388571 | 3300042636 | Bacteria | 6314 |
| 97 | Ga0466727_048202 | 3300042655 | Bacteria | 1180 |
| 98 | Ga0466727_303907 | 3300042655 | Bacteria | 1526 |
| 99 | Ga0466705_335597 | 3300042612 | Bacteria | 1087 |
| 100 | Ga0466691_098861 | 3300042593 | Bacteria | 10921 |
| 101 | Ga0466696_109501 | 3300042596 | Bacteria | 5683 |
| 102 | Ga0466715_331695 | 3300042616 | Bacteria | 1559 |
| 103 | Ga0466715_380110 | 3300042616 | Bacteria | 5706 |
| 104 | Ga0466715_559163 | 3300042616 | Bacteria | 16833 |
| 105 | Ga0466723_070462 | 3300042618 | Bacteria | 3135 |
| 106 | Ga0466723_184069 | 3300042618 | Bacteria | 1662 |
| 107 | Ga0466723_353717 | 3300042618 | Bacteria | 1643 |
| 108 | Ga0466726_483980 | 3300042619 | Bacteria | 1069 |
| 109 | Ga0466729_047992 | 3300042621 | Bacteria | 1235 |
| 110 | Ga0466713_154215 | 3300042602 | Bacteria | 7795 |
| 111 | Ga0466719_094926 | 3300042606 | Bacteria | 19772 |
| 112 | Ga0466735_113562 | 3300042624 | Unclassified | 1553 |
| 113 | Ga0466704_149478 | 3300042643 | Bacteria | 7699 |
| 114 | Ga0466709_204132 | 3300042648 | Bacteria | 8772 |
| 115 | Ga0466708_154220 | 3300042652 | Bacteria | 1818 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.