Protein Family IF08701
Metagenome
Isolate
278
Members
115
Samples
239
Scaffolds
190.4
Avg Length
Representative Sequence
- ID
- 3300042623|Ga0466734_139753|Ga0466734_139753_11722_12369
- Length
- 215 aa
- Sequence
- MQKNNQHTSKVSNQKSPLRGAGGRILIFDNYDSFTYNLVQLVEKISQQKIDVYRNDKISLEEMDRYDKIILSPGPGIPEEAGLLLPLIKTYASRKSILGVCLGHQAIGEAFGGTLVNLSKVYHGVATNCKIIGADEKLFKNIPKEFKAGRYHSWVIDQKNFPSELEITALDDNNMIMAIKHKQYDVRGVQFHPESILTPMGEQILRNWLNRLNED
Sample Types
Isolate
14.0%
Metagenome
86.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.4%
Blattidae
16.5%
Kalotermitidae
13.6%
Armadillidiidae
7.8%
Culicidae
4.9%
Drosophilidae
4.9%
Formicidae
4.9%
Termopsidae
3.9%
Unclassified
2.9%
Rhinotermitidae
2.9%
Passalidae
2.9%
Elmidae
2.9%
Pseudophyllodromiidae
1.9%
Daphniidae
1.0%
Hydrophilidae
1.0%
Apidae
1.0%
Tenebrionidae
1.0%
Blaberidae
1.0%
Lamproblattidae
1.0%
Bombycidae
1.0%
Cambaridae
1.0%
Anaplectidae
1.0%
Tryonicidae
1.0%
Taxonomy
Archaea
1
Bacteria
263
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 2 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 5 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 16 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 17 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 18 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 22 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 23 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 24 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 29 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 30 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 31 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 32 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 33 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 34 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 41 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 42 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 43 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 44 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 45 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 46 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 51 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 52 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 53 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 54 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 55 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 56 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 57 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 58 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 59 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 60 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 61 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 62 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 63 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 65 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 66 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 67 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 68 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 69 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 70 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 71 | 3300005320 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut | Metagenome | Drosophilidae |
| 72 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 73 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 74 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 75 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 76 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 77 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 78 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 79 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 80 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 81 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 82 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 83 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 84 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 85 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 86 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 87 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 88 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 89 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 90 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 91 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 92 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 93 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 94 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 95 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 96 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 97 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 98 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 99 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 100 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 101 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 102 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 103 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 104 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 105 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 106 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 107 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 108 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 109 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 110 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 111 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 112 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 113 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 114 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 115 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_170029 | 3300042659 | Bacteria | 24463 |
| 2 | Ga0160456_100015 | 3300012820 | Bacteria | 326465 |
| 3 | Ga0160472_101233 | 3300012839 | Bacteria | 8208 |
| 4 | Ga0466690_009119 | 3300042590 | Bacteria | 57867 |
| 5 | Ga0466690_216593 | 3300042590 | Bacteria | 11587 |
| 6 | Ga0466696_033740 | 3300042596 | Bacteria | 2149 |
| 7 | Ga0466709_262984 | 3300042648 | Bacteria | 8518 |
| 8 | Ga0466708_041887 | 3300042652 | Bacteria | 6797 |
| 9 | Ga0466727_127655 | 3300042655 | Bacteria | 11887 |
| 10 | Ga0466711_000292 | 3300042615 | Bacteria | 8850 |
| 11 | Ga0466711_002735 | 3300042615 | Bacteria | 8441 |
| 12 | Ga0466715_045342 | 3300042616 | Bacteria | 6772 |
| 13 | Ga0466723_346543 | 3300042618 | Bacteria | 25857 |
| 14 | Ga0466701_060315 | 3300042598 | Unclassified | 2737 |
| 15 | Ga0466707_065750 | 3300042601 | Bacteria | 28818 |
| 16 | Ga0466707_146540 | 3300042601 | Bacteria | 20716 |
| 17 | Ga0466716_172046 | 3300042605 | Bacteria | 3531 |
| 18 | Ga0466716_425991 | 3300042605 | Bacteria | 3443 |
| 19 | Ga0466719_059687 | 3300042606 | Bacteria | 12859 |
| 20 | Ga0466719_440976 | 3300042606 | Bacteria | 4466 |
| 21 | Ga0466722_052959 | 3300042609 | Bacteria | 9542 |
| 22 | Ga0068305_10040460 | 3300005083 | Unclassified | 3079 |
| 23 | Ga0068305_10126352 | 3300005083 | Bacteria | 4519 |
| 24 | Ga0104045_1005457 | 3300007085 | Bacteria | 8619 |
| 25 | Ga0104045_1016806 | 3300007085 | Bacteria | 933 |
| 26 | Ga0102740_1002860 | 3300007140 | Bacteria | 3827 |
| 27 | Ga0104048_1002207 | 3300007143 | Bacteria | 17136 |
| 28 | Ga0104048_1169210 | 3300007143 | Bacteria | 2265 |
| 29 | Ga0104048_1184356 | 3300007143 | Bacteria | 662 |
| 30 | Ga0104019_1002611 | 3300007150 | Unclassified | 1971 |
| 31 | Ga0466697_127742 | 3300042611 | Bacteria | 1161 |
| 32 | Ga0466705_202926 | 3300042612 | Bacteria | 22976 |
| 33 | Ga0160469_100036 | 3300012824 | Bacteria | 248494 |
| 34 | Ga0160469_101864 | 3300012824 | Bacteria | 4782 |
| 35 | Ga0160441_100026 | 3300012825 | Bacteria | 245262 |
| 36 | Ga0160455_100119 | 3300012837 | Bacteria | 109702 |
| 37 | Ga0466690_041158 | 3300042590 | Bacteria | 8601 |
| 38 | Ga0466692_004720 | 3300042591 | Bacteria | 21665 |
| 39 | Ga0466696_359729 | 3300042596 | Bacteria | 8179 |
| 40 | Ga0160442_100009 | 3300012806 | Bacteria | 498468 |
| 41 | Ga0466735_151877 | 3300042624 | Bacteria | 3924 |
| 42 | Ga0466703_229514 | 3300042636 | Bacteria | 9538 |
| 43 | Ga0466704_182716 | 3300042643 | Bacteria | 28436 |
| 44 | Ga0466725_059721 | 3300042654 | Bacteria | 3126 |
| 45 | Ga0466727_179577 | 3300042655 | Bacteria | 6699 |
| 46 | Ga0466715_256528 | 3300042616 | Bacteria | 31335 |
| 47 | Ga0466723_266272 | 3300042618 | Bacteria | 11868 |
| 48 | Ga0466726_322858 | 3300042619 | Bacteria | 2206 |
| 49 | Ga0466726_335684 | 3300042619 | Bacteria | 1746 |
| 50 | Ga0466728_138171 | 3300042620 | Bacteria | 48750 |
| 51 | Ga0466728_374388 | 3300042620 | Bacteria | 11393 |
| 52 | Ga0466701_060991 | 3300042598 | Bacteria | 19763 |
| 53 | Ga0466716_059223 | 3300042605 | Bacteria | 12106 |
| 54 | Ga0466716_115117 | 3300042605 | Bacteria | 8279 |
| 55 | Ga0466719_256888 | 3300042606 | Bacteria | 9371 |
| 56 | Ga0466719_335349 | 3300042606 | Bacteria | 8254 |
| 57 | Ga0466722_023509 | 3300042609 | Bacteria | 7337 |
| 58 | Ga0466722_086349 | 3300042609 | Bacteria | 7744 |
| 59 | 2226991477 | 2225789003 | Bacteria | 7328 |
| 60 | IMNBL1DRAFT_c0001897 | 3300000062 | Bacteria | 15159 |
| 61 | Ga0072940_1198352 | 3300005200 | Bacteria | 1515 |
| 62 | Ga0160455_100023 | 3300012837 | Bacteria | 373908 |
| 63 | Ga0160457_1001699 | 3300012858 | Bacteria | 5590 |
| 64 | Ga0466691_034694 | 3300042593 | Bacteria | 2534 |
| 65 | Ga0123357_10004506 | 3300009784 | Bacteria | 16374 |
| 66 | Ga0466729_261901 | 3300042621 | Bacteria | 8179 |
| 67 | Ga0466734_139753 | 3300042623 | Bacteria | 15723 |
| 68 | Ga0466703_089300 | 3300042636 | Unclassified | 1997 |
| 69 | Ga0466703_127121 | 3300042636 | Bacteria | 4735 |
| 70 | Ga0466704_072309 | 3300042643 | Bacteria | 9718 |
| 71 | Ga0466709_317083 | 3300042648 | Bacteria | 10979 |
| 72 | Ga0466724_34099 | 3300042649 | Bacteria | 50135 |
| 73 | Ga0466711_039476 | 3300042615 | Bacteria | 9362 |
| 74 | Ga0466715_092462 | 3300042616 | Bacteria | 14118 |
| 75 | Ga0466715_332864 | 3300042616 | Bacteria | 20648 |
| 76 | Ga0466723_005656 | 3300042618 | Bacteria | 20094 |
| 77 | Ga0466723_149172 | 3300042618 | Bacteria | 10747 |
| 78 | Ga0466726_011106 | 3300042619 | Bacteria | 2253 |
| 79 | Ga0466726_417570 | 3300042619 | Bacteria | 5617 |
| 80 | Ga0466701_097399 | 3300042598 | Bacteria | 121087 |
| 81 | Ga0466713_087763 | 3300042602 | Bacteria | 5097 |
| 82 | Ga0466716_056980 | 3300042605 | Bacteria | 2618 |
| 83 | Ga0466716_073619 | 3300042605 | Bacteria | 3070 |
| 84 | Ga0466716_101528 | 3300042605 | Bacteria | 7751 |
| 85 | Ga0466719_362367 | 3300042606 | Bacteria | 6140 |
| 86 | Ga0466719_549364 | 3300042606 | Bacteria | 1731 |
| 87 | Ga0466722_029126 | 3300042609 | Bacteria | 18315 |
| 88 | Ga0466698_405024 | 3300042610 | Bacteria | 2802 |
| 89 | Ga0068302_10068558 | 3300005071 | Bacteria | 2573 |
| 90 | Ga0072940_1162228 | 3300005200 | Bacteria | 1033 |
| 91 | Ga0074317_1137103 | 3300005320 | Bacteria | 1152 |
| 92 | Ga0160435_1000011 | 3300012857 | Bacteria | 218385 |
| 93 | Ga0160436_1031540 | 3300012861 | Unclassified | 899 |
| 94 | Ga0466690_051060 | 3300042590 | Bacteria | 5615 |
| 95 | Ga0466690_146168 | 3300042590 | Bacteria | 9301 |
| 96 | Ga0466696_022318 | 3300042596 | Bacteria | 4749 |
| 97 | Ga0466696_056325 | 3300042596 | Archaea | 2458 |
| 98 | Ga0466735_119800 | 3300042624 | Bacteria | 1445 |
| 99 | Ga0466704_046977 | 3300042643 | Bacteria | 19141 |
| 100 | Ga0466709_229045 | 3300042648 | Bacteria | 12197 |
| 101 | Ga0466709_402391 | 3300042648 | Bacteria | 2631 |
| 102 | Ga0466711_039975 | 3300042615 | Bacteria | 2662 |
| 103 | Ga0466715_320122 | 3300042616 | Bacteria | 8709 |
| 104 | Ga0466726_278784 | 3300042619 | Bacteria | 3184 |
| 105 | Ga0466728_063512 | 3300042620 | Bacteria | 17946 |
| 106 | Ga0466701_074981 | 3300042598 | Unclassified | 6242 |
| 107 | Ga0466707_211840 | 3300042601 | Bacteria | 2216 |
| 108 | Ga0466713_007597 | 3300042602 | Bacteria | 1041 |
| 109 | Ga0466713_063729 | 3300042602 | Bacteria | 12002 |
| 110 | Ga0466713_128661 | 3300042602 | Bacteria | 1291 |
| 111 | Ga0466716_244033 | 3300042605 | Bacteria | 1213 |
| 112 | 2227499637 | 2225789004 | Bacteria | 19389 |
| 113 | IMNBL1DRAFT_c0002452 | 3300000062 | Bacteria | 12900 |
| 114 | CVPL010W_10000093 | 3300002931 | Bacteria | 63242 |
| 115 | Ga0104050_1002449 | 3300007153 | Bacteria | 11607 |
| 116 | Ga0104050_1031738 | 3300007153 | Unclassified | 4090 |
| 117 | Ga0466705_019926 | 3300042612 | Bacteria | 9861 |
| 118 | Ga0466705_062779 | 3300042612 | Unclassified | 2198 |
| 119 | Ga0466705_271306 | 3300042612 | Bacteria | 7767 |
| 120 | Ga0160446_100001 | 3300012835 | Bacteria | 625222 |
| 121 | Ga0466657_018783 | 3300042582 | Bacteria | 1408 |
| 122 | Ga0466691_033852 | 3300042593 | Bacteria | 11172 |
| 123 | Ga0466694_388110 | 3300042594 | Bacteria | 1375 |
| 124 | Ga0466696_053612 | 3300042596 | Bacteria | 7089 |
| 125 | Ga0123353_10092708 | 3300010167 | Bacteria | 4866 |
| 126 | Ga0466703_104739 | 3300042636 | Bacteria | 9198 |
| 127 | Ga0466704_521025 | 3300042643 | Bacteria | 3681 |
| 128 | Ga0466724_10805 | 3300042649 | Unclassified | 2081 |
| 129 | Ga0466708_066300 | 3300042652 | Bacteria | 36627 |
| 130 | Ga0466727_196550 | 3300042655 | Bacteria | 5583 |
| 131 | Ga0466711_246719 | 3300042615 | Bacteria | 27110 |
| 132 | Ga0466715_628507 | 3300042616 | Bacteria | 8290 |
| 133 | Ga0466715_634151 | 3300042616 | Bacteria | 6543 |
| 134 | Ga0466718_108197 | 3300042617 | Bacteria | 2030 |
| 135 | Ga0466723_049435 | 3300042618 | Bacteria | 1003 |
| 136 | Ga0466726_375253 | 3300042619 | Bacteria | 1383 |
| 137 | Ga0466728_060040 | 3300042620 | Bacteria | 11052 |
| 138 | Ga0466713_156835 | 3300042602 | Bacteria | 2930 |
| 139 | Ga0466714_111320 | 3300042603 | Bacteria | 185233 |
| 140 | Ga0466716_317780 | 3300042605 | Bacteria | 2050 |
| 141 | Ga0466720_160767 | 3300042607 | Bacteria | 1024 |
| 142 | Ga0466722_104348 | 3300042609 | Bacteria | 5118 |
| 143 | 2227138327 | 2225789004 | Bacteria | 1632 |
| 144 | IMNBL1DRAFT_c0004236 | 3300000062 | Bacteria | 8705 |
| 145 | Ga0102735_1000879 | 3300007080 | Bacteria | 5518 |
| 146 | Ga0160431_100285 | 3300012828 | Bacteria | 29450 |
| 147 | Ga0160460_100013 | 3300012845 | Bacteria | 460073 |
| 148 | Ga0160445_100097 | 3300012847 | Bacteria | 88551 |
| 149 | Ga0466690_009130 | 3300042590 | Bacteria | 7030 |
| 150 | Ga0466690_015343 | 3300042590 | Bacteria | 7118 |
| 151 | Ga0466691_167802 | 3300042593 | Bacteria | 22476 |
| 152 | Ga0466696_140797 | 3300042596 | Bacteria | 4085 |
| 153 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 154 | Ga0466696_394191 | 3300042596 | Bacteria | 7861 |
| 155 | Ga0466699_066155 | 3300042597 | Bacteria | 1025 |
| 156 | Ga0466730_009837 | 3300042625 | Bacteria | 325641 |
| 157 | Ga0466703_107170 | 3300042636 | Bacteria | 5745 |
| 158 | Ga0466703_286689 | 3300042636 | Bacteria | 12299 |
| 159 | Ga0466704_078568 | 3300042643 | Bacteria | 13182 |
| 160 | Ga0466724_06985 | 3300042649 | Bacteria | 79949 |
| 161 | Ga0466708_135441 | 3300042652 | Bacteria | 21711 |
| 162 | Ga0466712_213057 | 3300042614 | Bacteria | 1181 |
| 163 | Ga0466711_060306 | 3300042615 | Bacteria | 4565 |
| 164 | Ga0466711_088592 | 3300042615 | Bacteria | 4606 |
| 165 | Ga0466715_471970 | 3300042616 | Bacteria | 21523 |
| 166 | Ga0466728_021081 | 3300042620 | Bacteria | 5228 |
| 167 | Ga0466728_147328 | 3300042620 | Bacteria | 4156 |
| 168 | Ga0466728_156870 | 3300042620 | Bacteria | 24732 |
| 169 | Ga0466728_410703 | 3300042620 | Bacteria | 8493 |
| 170 | Ga0466701_044550 | 3300042598 | Bacteria | 48935 |
| 171 | Ga0466701_096150 | 3300042598 | Unclassified | 53495 |
| 172 | Ga0466707_219452 | 3300042601 | Bacteria | 5700 |
| 173 | Ga0466719_520451 | 3300042606 | Bacteria | 5093 |
| 174 | Ga0466722_157787 | 3300042609 | Bacteria | 8128 |
| 175 | IMNBL1DRAFT_c0004122 | 3300000062 | Bacteria | 8875 |
| 176 | IMNBL1DRAFT_c0051141 | 3300000062 | Bacteria | 1303 |
| 177 | Ga0068302_10102124 | 3300005071 | Bacteria | 8884 |
| 178 | Ga0072940_1136793 | 3300005200 | Bacteria | 3211 |
| 179 | Ga0103263_110000 | 3300007042 | Bacteria | 977 |
| 180 | Ga0104045_1002750 | 3300007085 | Unclassified | 17842 |
| 181 | Ga0102734_1000640 | 3300007129 | Bacteria | 13948 |
| 182 | Ga0104048_1022506 | 3300007143 | Bacteria | 3589 |
| 183 | Ga0104019_1000350 | 3300007150 | Unclassified | 3390 |
| 184 | Ga0104019_1004048 | 3300007150 | Bacteria | 10189 |
| 185 | Ga0466705_009779 | 3300042612 | Bacteria | 2863 |
| 186 | Ga0466705_095082 | 3300042612 | Bacteria | 6691 |
| 187 | Ga0160468_100065 | 3300012819 | Bacteria | 140978 |
| 188 | Ga0160433_100528 | 3300012846 | Bacteria | 17507 |
| 189 | Ga0160457_1011524 | 3300012858 | Bacteria | 1251 |
| 190 | Ga0160457_1013616 | 3300012858 | Unclassified | 1148 |
| 191 | Ga0466690_102107 | 3300042590 | Bacteria | 2116 |
| 192 | Ga0466692_135295 | 3300042591 | Bacteria | 1359 |
| 193 | Ga0466696_017034 | 3300042596 | Bacteria | 23314 |
| 194 | Ga0466696_310383 | 3300042596 | Bacteria | 1253 |
| 195 | Ga0466735_210636 | 3300042624 | Bacteria | 3415 |
| 196 | Ga0466735_220934 | 3300042624 | Bacteria | 9943 |
| 197 | Ga0466703_084181 | 3300042636 | Bacteria | 6979 |
| 198 | Ga0466724_39249 | 3300042649 | Bacteria | 11625 |
| 199 | Ga0466727_218108 | 3300042655 | Bacteria | 13790 |
| 200 | Ga0466711_139999 | 3300042615 | Bacteria | 3103 |
| 201 | Ga0466718_129503 | 3300042617 | Bacteria | 1538 |
| 202 | Ga0466726_056753 | 3300042619 | Bacteria | 6474 |
| 203 | Ga0466728_047470 | 3300042620 | Bacteria | 2485 |
| 204 | Ga0466701_037660 | 3300042598 | Bacteria | 59723 |
| 205 | Ga0466707_387304 | 3300042601 | Bacteria | 7418 |
| 206 | 2227005365 | 2225789003 | Bacteria | 5831 |
| 207 | JGI24702J35022_10063217 | 3300002462 | Bacteria | 1983 |
| 208 | Ga0072941_1492302 | 3300005201 | Bacteria | 2626 |
| 209 | Ga0104045_1082238 | 3300007085 | Bacteria | 1068 |
| 210 | Ga0466705_154185 | 3300042612 | Bacteria | 4715 |
| 211 | Ga0466727_351952 | 3300042655 | Bacteria | 33342 |
| 212 | Ga0466733_174663 | 3300042659 | Bacteria | 24320 |
| 213 | Ga0160453_100226 | 3300012814 | Bacteria | 54682 |
| 214 | Ga0160444_100978 | 3300012841 | Bacteria | 7116 |
| 215 | Ga0160433_100067 | 3300012846 | Bacteria | 112579 |
| 216 | Ga0160433_100205 | 3300012846 | Bacteria | 46543 |
| 217 | Ga0466693_258385 | 3300042592 | Bacteria | 1283 |
| 218 | Ga0466691_081188 | 3300042593 | Bacteria | 1642 |
| 219 | Ga0466696_042333 | 3300042596 | Bacteria | 20220 |
| 220 | Ga0466696_210690 | 3300042596 | Bacteria | 2690 |
| 221 | Ga0466696_468029 | 3300042596 | Bacteria | 21396 |
| 222 | Ga0123353_10094925 | 3300010167 | Bacteria | 4805 |
| 223 | Ga0123353_10616869 | 3300010167 | Bacteria | 1546 |
| 224 | Ga0466703_017988 | 3300042636 | Bacteria | 8088 |
| 225 | Ga0466703_193906 | 3300042636 | Bacteria | 13353 |
| 226 | Ga0466704_287840 | 3300042643 | Bacteria | 8466 |
| 227 | Ga0466704_375024 | 3300042643 | Bacteria | 17873 |
| 228 | Ga0466727_011393 | 3300042655 | Bacteria | 3964 |
| 229 | Ga0466727_019825 | 3300042655 | Bacteria | 16582 |
| 230 | Ga0466711_483677 | 3300042615 | Bacteria | 2037 |
| 231 | Ga0466715_239786 | 3300042616 | Bacteria | 13840 |
| 232 | Ga0466723_004496 | 3300042618 | Bacteria | 7998 |
| 233 | Ga0466723_060434 | 3300042618 | Bacteria | 19796 |
| 234 | Ga0466723_274307 | 3300042618 | Unclassified | 2586 |
| 235 | Ga0466707_253044 | 3300042601 | Bacteria | 4303 |
| 236 | Ga0466717_167537 | 3300042604 | Bacteria | 1074 |
| 237 | Ga0466722_040785 | 3300042609 | Bacteria | 21885 |
| 238 | Ga0466722_121135 | 3300042609 | Bacteria | 11462 |
| 239 | Ga0104045_1003465 | 3300007085 | Bacteria | 3876 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07722 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.