Protein Family IF08607
Metagenome
Isolate
125
Members
48
Samples
124
Scaffolds
78.66
Avg Length
Representative Sequence
- ID
- 3300042622|Ga0466731_223212|Ga0466731_223212_320_598
- Length
- 92 aa
- Sequence
- MNSKKSVFLQKIFDMETRVLNKENRDEISFMSFIIPEFAAAYKMSVQNAYRYLKQYGGLDYLHEHWWALHTDNPFWAVRDMFEICRQNGGLK
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
60.4%
Kalotermitidae
16.7%
Termopsidae
8.3%
Unclassified
6.2%
Rhinotermitidae
4.2%
Passalidae
4.2%
Taxonomy
Archaea
1
Bacteria
92
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10052886 | 3300002462 | Unclassified | 2165 |
| 2 | JGI24702J35022_10452045 | 3300002462 | Bacteria | 782 |
| 3 | Ga0068302_10036627 | 3300005071 | Unclassified | 6497 |
| 4 | Ga0466705_277920 | 3300042612 | Bacteria | 1063 |
| 5 | Ga0466701_061116 | 3300042598 | Bacteria | 1269 |
| 6 | Ga0466701_096101 | 3300042598 | Bacteria | 1871 |
| 7 | Ga0466713_055128 | 3300042602 | Bacteria | 14066 |
| 8 | Ga0466716_241732 | 3300042605 | Unclassified | 2546 |
| 9 | Ga0123356_11789729 | 3300010049 | Bacteria | 763 |
| 10 | Ga0123353_10144000 | 3300010167 | Unclassified | 3814 |
| 11 | Ga0123353_12038437 | 3300010167 | Bacteria | 701 |
| 12 | Ga0123353_12295896 | 3300010167 | Unclassified | 649 |
| 13 | Ga0123354_10899535 | 3300010882 | Bacteria | 581 |
| 14 | Ga0466726_332846 | 3300042619 | Bacteria | 4396 |
| 15 | Ga0466729_070718 | 3300042621 | Unclassified | 1573 |
| 16 | JGI24702J35022_10010055 | 3300002462 | Bacteria | 5300 |
| 17 | JGI24702J35022_10347582 | 3300002462 | Bacteria | 886 |
| 18 | JGI24696J40584_12915729 | 3300002834 | Bacteria | 1297 |
| 19 | JGI24696J40584_12941395 | 3300002834 | Unclassified | 1706 |
| 20 | Ga0466697_126340 | 3300042611 | Bacteria | 1187 |
| 21 | Ga0466697_252055 | 3300042611 | Bacteria | 1116 |
| 22 | Ga0466722_052222 | 3300042609 | Bacteria | 1996 |
| 23 | Ga0466694_023999 | 3300042594 | Archaea | 1785 |
| 24 | Ga0466694_279366 | 3300042594 | Bacteria | 2239 |
| 25 | Ga0466699_416992 | 3300042597 | Bacteria | 1026 |
| 26 | Ga0466709_407292 | 3300042648 | Bacteria | 7567 |
| 27 | Ga0123356_12059715 | 3300010049 | Bacteria | 712 |
| 28 | Ga0123356_13115242 | 3300010049 | Bacteria | 578 |
| 29 | Ga0123353_10672754 | 3300010167 | Bacteria | 1460 |
| 30 | Ga0466710_196462 | 3300042613 | Unclassified | 3935 |
| 31 | Ga0466711_217944 | 3300042615 | Bacteria | 1570 |
| 32 | Ga0466726_163262 | 3300042619 | Unclassified | 2010 |
| 33 | JGI24702J35022_10020786 | 3300002462 | Bacteria | 3561 |
| 34 | JGI24702J35022_10474841 | 3300002462 | Bacteria | 764 |
| 35 | JGI24696J40584_12721944 | 3300002834 | Unclassified | 760 |
| 36 | Ga0068302_10257093 | 3300005071 | Unclassified | 5128 |
| 37 | Ga0072940_1300532 | 3300005200 | Bacteria | 651 |
| 38 | Ga0466700_289090 | 3300042600 | Bacteria | 2380 |
| 39 | Ga0466719_109983 | 3300042606 | Bacteria | 3918 |
| 40 | Ga0466693_308397 | 3300042592 | Unclassified | 1046 |
| 41 | Ga0466735_043073 | 3300042624 | Bacteria | 1773 |
| 42 | Ga0466704_145222 | 3300042643 | Unclassified | 1812 |
| 43 | Ga0466727_206877 | 3300042655 | Bacteria | 1730 |
| 44 | Ga0123353_10101335 | 3300010167 | Bacteria | 4642 |
| 45 | Ga0123353_11501220 | 3300010167 | Unclassified | 858 |
| 46 | Ga0466726_118995 | 3300042619 | Unclassified | 1185 |
| 47 | 2227100547 | 2225789004 | Unclassified | 1793 |
| 48 | JGI24695J34938_10071687 | 3300002450 | Bacteria | 1447 |
| 49 | Ga0466733_005673 | 3300042659 | Bacteria | 2609 |
| 50 | Ga0466695_315857 | 3300042595 | Bacteria | 1101 |
| 51 | Ga0123356_11338035 | 3300010049 | Bacteria | 879 |
| 52 | Ga0123353_10000596 | 3300010167 | Bacteria | 44224 |
| 53 | Ga0123353_10463982 | 3300010167 | Bacteria | 1860 |
| 54 | Ga0123353_10602160 | 3300010167 | Bacteria | 1570 |
| 55 | Ga0123353_10626433 | 3300010167 | Unclassified | 1530 |
| 56 | Ga0123353_10916047 | 3300010167 | Unclassified | 1191 |
| 57 | Ga0123353_12754884 | 3300010167 | Bacteria | 577 |
| 58 | Ga0123354_10785671 | 3300010882 | Unclassified | 645 |
| 59 | Ga0466712_174729 | 3300042614 | Bacteria | 1035 |
| 60 | 2227527418 | 2225789004 | Unclassified | 3221 |
| 61 | JGI24695J34938_10326907 | 3300002450 | Bacteria | 668 |
| 62 | JGI24705J35276_12229198 | 3300002504 | Bacteria | 3340 |
| 63 | JGI24696J40584_12912702 | 3300002834 | Bacteria | 1269 |
| 64 | JGI24696J40584_12935045 | 3300002834 | Bacteria | 1551 |
| 65 | Ga0466698_245352 | 3300042610 | Bacteria | 1445 |
| 66 | Ga0466697_049557 | 3300042611 | Bacteria | 2364 |
| 67 | Ga0466693_163877 | 3300042592 | Bacteria | 1592 |
| 68 | Ga0466704_028716 | 3300042643 | Bacteria | 4487 |
| 69 | Ga0123356_10091830 | 3300010049 | Unclassified | 2894 |
| 70 | Ga0123353_10273257 | 3300010167 | Unclassified | 2602 |
| 71 | Ga0123354_10223264 | 3300010882 | Unclassified | 1994 |
| 72 | Ga0466726_165130 | 3300042619 | Bacteria | 9787 |
| 73 | Ga0466728_027601 | 3300042620 | Bacteria | 1679 |
| 74 | 2227498687 | 2225789004 | Bacteria | 752 |
| 75 | Ga0068302_10000338 | 3300005071 | Bacteria | 1513 |
| 76 | Ga0466705_145068 | 3300042612 | Bacteria | 3429 |
| 77 | Ga0466707_026359 | 3300042601 | Bacteria | 29357 |
| 78 | Ga0466714_150337 | 3300042603 | Unclassified | 1342 |
| 79 | Ga0466719_298547 | 3300042606 | Bacteria | 1474 |
| 80 | Ga0466698_015593 | 3300042610 | Unclassified | 1408 |
| 81 | Ga0466657_367601 | 3300042582 | Bacteria | 1206 |
| 82 | Ga0466694_394768 | 3300042594 | Bacteria | 1257 |
| 83 | Ga0466731_223212 | 3300042622 | Bacteria | 1493 |
| 84 | Ga0466725_237722 | 3300042654 | Bacteria | 4856 |
| 85 | Ga0466725_254470 | 3300042654 | Bacteria | 1440 |
| 86 | Ga0123356_10273685 | 3300010049 | Bacteria | 1780 |
| 87 | Ga0123356_10991871 | 3300010049 | Unclassified | 1010 |
| 88 | Ga0123356_11335514 | 3300010049 | Bacteria | 879 |
| 89 | Ga0123356_11941420 | 3300010049 | Bacteria | 733 |
| 90 | Ga0123353_10265423 | 3300010167 | Bacteria | 2649 |
| 91 | Ga0123353_12016236 | 3300010167 | Unclassified | 706 |
| 92 | Ga0466710_077121 | 3300042613 | Bacteria | 3249 |
| 93 | Ga0466710_093899 | 3300042613 | Bacteria | 4418 |
| 94 | Ga0466728_042179 | 3300042620 | Bacteria | 1088 |
| 95 | JGI24702J35022_10059680 | 3300002462 | Bacteria | 2038 |
| 96 | JGI24702J35022_10686127 | 3300002462 | Unclassified | 636 |
| 97 | JGI24702J35022_10735049 | 3300002462 | Unclassified | 614 |
| 98 | Ga0466705_034917 | 3300042612 | Bacteria | 1460 |
| 99 | Ga0466700_333255 | 3300042600 | Bacteria | 1438 |
| 100 | Ga0466721_265413 | 3300042608 | Bacteria | 1284 |
| 101 | Ga0466704_038561 | 3300042643 | Bacteria | 1037 |
| 102 | Ga0466704_211599 | 3300042643 | Unclassified | 3289 |
| 103 | Ga0123356_10182967 | 3300010049 | Unclassified | 2119 |
| 104 | Ga0466718_109604 | 3300042617 | Bacteria | 1929 |
| 105 | Ga0466726_030060 | 3300042619 | Bacteria | 20392 |
| 106 | 2227217485 | 2225789004 | Bacteria | 1397 |
| 107 | IMNBL1DRAFT_c0000361 | 3300000062 | Bacteria | 38553 |
| 108 | IMNBL1DRAFT_c0093580 | 3300000062 | Bacteria | 819 |
| 109 | AustNasuHG_c1087726 | 3300000089 | Bacteria | 507 |
| 110 | JGI24702J35022_10466656 | 3300002462 | Bacteria | 770 |
| 111 | Ga0466697_135563 | 3300042611 | Bacteria | 4244 |
| 112 | Ga0466697_281457 | 3300042611 | Bacteria | 1312 |
| 113 | Ga0466705_087353 | 3300042612 | Bacteria | 6412 |
| 114 | Ga0466721_090949 | 3300042608 | Unclassified | 1100 |
| 115 | Ga0415639_264280 | 3300038395 | Bacteria | 1076 |
| 116 | Ga0466690_069563 | 3300042590 | Bacteria | 1026 |
| 117 | Ga0466694_364307 | 3300042594 | Bacteria | 3543 |
| 118 | Ga0466734_073161 | 3300042623 | Bacteria | 1824 |
| 119 | Ga0466709_029442 | 3300042648 | Bacteria | 27734 |
| 120 | Ga0466727_146729 | 3300042655 | Bacteria | 1271 |
| 121 | Ga0123357_10021470 | 3300009784 | Bacteria | 8648 |
| 122 | Ga0123356_11407901 | 3300010049 | Bacteria | 857 |
| 123 | Ga0123353_10975033 | 3300010167 | Bacteria | 1143 |
| 124 | Ga0466711_262525 | 3300042615 | Bacteria | 1879 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300000089 | AustNasuHG_c1087726 | AustNasuHG_10877262 | 75 |
| 2 | 2225789004 | 2227217485 | 2227648568 | 76 |
| 3 | 3300005200 | Ga0072940_1300532 | Ga0072940_13005321 | 76 |
| 4 | 3300010167 | Ga0123353_12016236 | Ga0123353_120162361 | 76 |
| 5 | 3300010167 | Ga0123353_12295896 | Ga0123353_122958961 | 76 |
| 6 | 3300010882 | Ga0123354_10899535 | Ga0123354_108995352 | 76 |
| 7 | 3300042590 | Ga0466690_069563 | Ga0466690_069563_102_332 | 76 |
| 8 | 3300042643 | Ga0466704_038561 | Ga0466704_038561_188_418 | 76 |
| 9 | 3300002462 | JGI24702J35022_10686127 | JGI24702J35022_106861272 | 77 |
| 10 | 3300010167 | Ga0123353_10602160 | Ga0123353_106021602 | 77 |
| 11 | 3300010167 | Ga0123353_10626433 | Ga0123353_106264331 | 77 |
| 12 | 3300042619 | Ga0466726_030060 | Ga0466726_030060_59_292 | 77 |
| 13 | 3300042619 | Ga0466726_118995 | Ga0466726_118995_833_1066 | 77 |
| 14 | 3300042619 | Ga0466726_163262 | Ga0466726_163262_1144_1377 | 77 |
| 15 | 3300042619 | Ga0466726_332846 | Ga0466726_332846_608_841 | 77 |
| 16 | 3300042620 | Ga0466728_027601 | Ga0466728_027601_913_1146 | 77 |
| 17 | 3300042655 | Ga0466727_146729 | Ga0466727_146729_65_298 | 77 |
| 18 | 3300042655 | Ga0466727_206877 | Ga0466727_206877_1241_1474 | 77 |
| 19 | 2225789004 | 2227100547 | 2227483914 | 78 |
| 20 | 2225789004 | 2227498687 | 2227978820 | 78 |
| 21 | 3300005071 | Ga0068302_10000338 | Ga0068302_100003383 | 78 |
| 22 | 3300005071 | Ga0068302_10036627 | Ga0068302_100366273 | 78 |
| 23 | 3300005071 | Ga0068302_10257093 | Ga0068302_102570934 | 78 |
| 24 | 3300038395 | Ga0415639_264280 | Ga0415639_264280_295_531 | 78 |
| 25 | 3300042582 | Ga0466657_367601 | Ga0466657_367601_746_982 | 78 |
| 26 | 3300042592 | Ga0466693_163877 | Ga0466693_163877_931_1167 | 78 |
| 27 | 3300042594 | Ga0466694_023999 | Ga0466694_023999_1299_1535 | 78 |
| 28 | 3300042594 | Ga0466694_279366 | Ga0466694_279366_1782_2018 | 78 |
| 29 | 3300042594 | Ga0466694_364307 | Ga0466694_364307_1812_2048 | 78 |
| 30 | 3300042594 | Ga0466694_394768 | Ga0466694_394768_430_666 | 78 |
| 31 | 3300042595 | Ga0466695_315857 | Ga0466695_315857_188_424 | 78 |
| 32 | 3300042597 | Ga0466699_416992 | Ga0466699_416992_95_331 | 78 |
| 33 | 3300042598 | Ga0466701_061116 | Ga0466701_061116_845_1081 | 78 |
| 34 | 3300042598 | Ga0466701_096101 | Ga0466701_096101_781_1017 | 78 |
| 35 | 3300042600 | Ga0466700_289090 | Ga0466700_289090_397_633 | 78 |
| 36 | 3300042600 | Ga0466700_333255 | Ga0466700_333255_307_543 | 78 |
| 37 | 3300042601 | Ga0466707_026359 | Ga0466707_026359_1153_1389 | 78 |
| 38 | 3300042602 | Ga0466713_055128 | Ga0466713_055128_13309_13545 | 78 |
| 39 | 3300042603 | Ga0466714_150337 | Ga0466714_150337_487_723 | 78 |
| 40 | 3300042606 | Ga0466719_109983 | Ga0466719_109983_3209_3445 | 78 |
| 41 | 3300042608 | Ga0466721_090949 | Ga0466721_090949_557_793 | 78 |
| 42 | 3300042608 | Ga0466721_265413 | Ga0466721_265413_273_509 | 78 |
| 43 | 3300042609 | Ga0466722_052222 | Ga0466722_052222_1453_1689 | 78 |
| 44 | 3300042610 | Ga0466698_015593 | Ga0466698_015593_326_562 | 78 |
| 45 | 3300042610 | Ga0466698_245352 | Ga0466698_245352_347_583 | 78 |
| 46 | 3300042611 | Ga0466697_049557 | Ga0466697_049557_1466_1702 | 78 |
| 47 | 3300042611 | Ga0466697_126340 | Ga0466697_126340_937_1173 | 78 |
| 48 | 3300042611 | Ga0466697_135563 | Ga0466697_135563_3996_4232 | 78 |
| 49 | 3300042611 | Ga0466697_252055 | Ga0466697_252055_463_699 | 78 |
| 50 | 3300042611 | Ga0466697_281457 | Ga0466697_281457_967_1203 | 78 |
| 51 | 3300042612 | Ga0466705_034917 | Ga0466705_034917_836_1072 | 78 |
| 52 | 3300042612 | Ga0466705_087353 | Ga0466705_087353_6108_6344 | 78 |
| 53 | 3300042612 | Ga0466705_145068 | Ga0466705_145068_2387_2623 | 78 |
| 54 | 3300042612 | Ga0466705_277920 | Ga0466705_277920_110_346 | 78 |
| 55 | 3300042613 | Ga0466710_077121 | Ga0466710_077121_2511_2747 | 78 |
| 56 | 3300042613 | Ga0466710_093899 | Ga0466710_093899_837_1073 | 78 |
| 57 | 3300042613 | Ga0466710_196462 | Ga0466710_196462_1156_1392 | 78 |
| 58 | 3300042614 | Ga0466712_174729 | Ga0466712_174729_398_634 | 78 |
| 59 | 3300042615 | Ga0466711_217944 | Ga0466711_217944_856_1092 | 78 |
| 60 | 3300042615 | Ga0466711_262525 | Ga0466711_262525_441_677 | 78 |
| 61 | 3300042619 | Ga0466726_165130 | Ga0466726_165130_6361_6597 | 78 |
| 62 | 3300042621 | Ga0466729_070718 | Ga0466729_070718_521_757 | 78 |
| 63 | 3300042623 | Ga0466734_073161 | Ga0466734_073161_657_893 | 78 |
| 64 | 3300042624 | Ga0466735_043073 | Ga0466735_043073_491_727 | 78 |
| 65 | 3300042643 | Ga0466704_028716 | Ga0466704_028716_3746_3982 | 78 |
| 66 | 3300042643 | Ga0466704_145222 | Ga0466704_145222_104_340 | 78 |
| 67 | 3300042643 | Ga0466704_211599 | Ga0466704_211599_802_1038 | 78 |
| 68 | 3300042648 | Ga0466709_029442 | Ga0466709_029442_15486_15722 | 78 |
| 69 | 3300042654 | Ga0466725_237722 | Ga0466725_237722_833_1069 | 78 |
| 70 | 3300042654 | Ga0466725_254470 | Ga0466725_254470_1010_1246 | 78 |
| 71 | 3300042659 | Ga0466733_005673 | Ga0466733_005673_1917_2153 | 78 |
| 72 | iso_pr_bacteria | 2820741847 | 2820743237 | 78 |
| 73 | 3300000062 | IMNBL1DRAFT_c0000361 | IMNBL1DRAFT_00003618 | 79 |
| 74 | 3300002450 | JGI24695J34938_10071687 | JGI24695J34938_100716872 | 79 |
| 75 | 3300002450 | JGI24695J34938_10326907 | JGI24695J34938_103269071 | 79 |
| 76 | 3300002462 | JGI24702J35022_10010055 | JGI24702J35022_100100555 | 79 |
| 77 | 3300002462 | JGI24702J35022_10020786 | JGI24702J35022_100207864 | 79 |
| 78 | 3300002462 | JGI24702J35022_10052886 | JGI24702J35022_100528863 | 79 |
| 79 | 3300002462 | JGI24702J35022_10059680 | JGI24702J35022_100596802 | 79 |
| 80 | 3300002462 | JGI24702J35022_10347582 | JGI24702J35022_103475821 | 79 |
| 81 | 3300002462 | JGI24702J35022_10452045 | JGI24702J35022_104520451 | 79 |
| 82 | 3300002462 | JGI24702J35022_10466656 | JGI24702J35022_104666561 | 79 |
| 83 | 3300002462 | JGI24702J35022_10474841 | JGI24702J35022_104748412 | 79 |
| 84 | 3300002462 | JGI24702J35022_10735049 | JGI24702J35022_107350492 | 79 |
| 85 | 3300002504 | JGI24705J35276_12229198 | JGI24705J35276_122291984 | 79 |
| 86 | 3300002834 | JGI24696J40584_12721944 | JGI24696J40584_127219442 | 79 |
| 87 | 3300002834 | JGI24696J40584_12912702 | JGI24696J40584_129127022 | 79 |
| 88 | 3300002834 | JGI24696J40584_12915729 | JGI24696J40584_129157293 | 79 |
| 89 | 3300002834 | JGI24696J40584_12935045 | JGI24696J40584_129350453 | 79 |
| 90 | 3300002834 | JGI24696J40584_12941395 | JGI24696J40584_129413953 | 79 |
| 91 | 3300009784 | Ga0123357_10021470 | Ga0123357_100214701 | 79 |
| 92 | 3300010049 | Ga0123356_10091830 | Ga0123356_100918303 | 79 |
| 93 | 3300010049 | Ga0123356_10182967 | Ga0123356_101829672 | 79 |
| 94 | 3300010049 | Ga0123356_10273685 | Ga0123356_102736852 | 79 |
| 95 | 3300010049 | Ga0123356_10991871 | Ga0123356_109918711 | 79 |
| 96 | 3300010049 | Ga0123356_11338035 | Ga0123356_113380352 | 79 |
| 97 | 3300010049 | Ga0123356_11407901 | Ga0123356_114079012 | 79 |
| 98 | 3300010049 | Ga0123356_11789729 | Ga0123356_117897292 | 79 |
| 99 | 3300010049 | Ga0123356_11941420 | Ga0123356_119414202 | 79 |
| 100 | 3300010049 | Ga0123356_12059715 | Ga0123356_120597151 | 79 |
| 101 | 3300010167 | Ga0123353_10000596 | Ga0123353_1000059639 | 79 |
| 102 | 3300010167 | Ga0123353_10101335 | Ga0123353_101013355 | 79 |
| 103 | 3300010167 | Ga0123353_10144000 | Ga0123353_101440003 | 79 |
| 104 | 3300010167 | Ga0123353_10265423 | Ga0123353_102654233 | 79 |
| 105 | 3300010167 | Ga0123353_10463982 | Ga0123353_104639822 | 79 |
| 106 | 3300010167 | Ga0123353_10672754 | Ga0123353_106727543 | 79 |
| 107 | 3300010167 | Ga0123353_10916047 | Ga0123353_109160472 | 79 |
| 108 | 3300010167 | Ga0123353_10975033 | Ga0123353_109750332 | 79 |
| 109 | 3300010167 | Ga0123353_12038437 | Ga0123353_120384372 | 79 |
| 110 | 3300010167 | Ga0123353_12754884 | Ga0123353_127548841 | 79 |
| 111 | 3300010882 | Ga0123354_10785671 | Ga0123354_107856712 | 79 |
| 112 | 3300042606 | Ga0466719_298547 | Ga0466719_298547_849_1088 | 79 |
| 113 | 3300042592 | Ga0466693_308397 | Ga0466693_308397_371_613 | 80 |
| 114 | 3300010049 | Ga0123356_11335514 | Ga0123356_113355142 | 81 |
| 115 | 3300010049 | Ga0123356_13115242 | Ga0123356_131152421 | 81 |
| 116 | 3300010167 | Ga0123353_10273257 | Ga0123353_102732573 | 81 |
| 117 | 3300010167 | Ga0123353_11501220 | Ga0123353_115012202 | 81 |
| 118 | 3300010882 | Ga0123354_10223264 | Ga0123354_102232642 | 81 |
| 119 | 3300042620 | Ga0466728_042179 | Ga0466728_042179_692_940 | 82 |
| 120 | 3300042648 | Ga0466709_407292 | Ga0466709_407292_2861_3109 | 82 |
| 121 | 2225789004 | 2227527418 | 2228036658 | 84 |
| 122 | 3300000062 | IMNBL1DRAFT_c0093580 | IMNBL1DRAFT_00935802 | 85 |
| 123 | 3300042605 | Ga0466716_241732 | Ga0466716_241732_2031_2291 | 86 |
| 124 | 3300042617 | Ga0466718_109604 | Ga0466718_109604_328_591 | 87 |
| 125 | 3300042622 | Ga0466731_223212 | Ga0466731_223212_320_598 | 92 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12668 | DUF3791 | Protein of unknown function (DUF3791) | 30 | 88 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.66 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.