Protein Family IF08566
Metagenome
Isolate
122
Members
52
Samples
121
Scaffolds
152.21
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_281581|Ga0466729_281581_187_792
- Length
- 180 aa
- Sequence
- LDDAKPPNGGIKSIPIDKRPEGTYDAEEPAARENLKEKIEYEISRIEKLLNDAKPLLDLCKIREPDFIEITAAAQILHSFYNGVESVVILFLKSINEKVPNDIRWHKTLFEVMFGTNSKNIPIIRRDIKEQMEKYMYFRHFIRHSYSSELKWNEMETLIKNLDEIWKIIKTDFEEFIKNN
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
64.0%
Kalotermitidae
22.0%
Rhinotermitidae
6.0%
Unclassified
4.0%
Termopsidae
4.0%
Taxonomy
Archaea
1
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 16 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 17 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 18 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 48 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 51 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_101293 | 3300024493 | Bacteria | 6812 |
| 2 | Ga0466692_074560 | 3300042591 | Bacteria | 1490 |
| 3 | Ga0466694_111083 | 3300042594 | Bacteria | 1232 |
| 4 | Ga0466695_106711 | 3300042595 | Bacteria | 1524 |
| 5 | Ga0466726_334002 | 3300042619 | Archaea | 1513 |
| 6 | Ga0466728_207933 | 3300042620 | Bacteria | 1279 |
| 7 | Ga0466722_007123 | 3300042609 | Bacteria | 4598 |
| 8 | Ga0466722_133773 | 3300042609 | Bacteria | 3490 |
| 9 | Ga0466698_199442 | 3300042610 | Bacteria | 1039 |
| 10 | Ga0466702_288451 | 3300042635 | Bacteria | 1054 |
| 11 | AustNasuHG_c1027363 | 3300000089 | Bacteria | 1744 |
| 12 | JGI24698J34947_10178584 | 3300002449 | Bacteria | 851 |
| 13 | JGI24705J35276_12154439 | 3300002504 | Bacteria | 1199 |
| 14 | JGI24697J35500_11271242 | 3300002507 | Unclassified | 4451 |
| 15 | Ga0072941_1172624 | 3300005201 | Bacteria | 1701 |
| 16 | Ga0466697_079626 | 3300042611 | Bacteria | 1276 |
| 17 | Ga0466733_117584 | 3300042659 | Bacteria | 1023 |
| 18 | Ga0466690_048814 | 3300042590 | Bacteria | 6755 |
| 19 | Ga0466694_323778 | 3300042594 | Bacteria | 1289 |
| 20 | Ga0466712_067097 | 3300042614 | Unclassified | 2218 |
| 21 | Ga0466726_281346 | 3300042619 | Bacteria | 2508 |
| 22 | Ga0466720_137685 | 3300042607 | Bacteria | 4268 |
| 23 | Ga0466729_281581 | 3300042621 | Bacteria | 1109 |
| 24 | Ga0466704_189215 | 3300042643 | Bacteria | 1642 |
| 25 | Ga0466708_123228 | 3300042652 | Bacteria | 7821 |
| 26 | Ga0123356_10016488 | 3300010049 | Bacteria | 7045 |
| 27 | Ga0123353_12255411 | 3300010167 | Bacteria | 657 |
| 28 | Ga0123354_10476795 | 3300010882 | Unclassified | 990 |
| 29 | AustNasuHG_c1002778 | 3300000089 | Bacteria | 6319 |
| 30 | JGI24698J34947_10199679 | 3300002449 | Bacteria | 784 |
| 31 | JGI24702J35022_10068692 | 3300002462 | Bacteria | 1905 |
| 32 | JGI24696J40584_12440194 | 3300002834 | Bacteria | 571 |
| 33 | Ga0466705_204401 | 3300042612 | Bacteria | 4117 |
| 34 | Ga0466733_123122 | 3300042659 | Bacteria | 58460 |
| 35 | Ga0466692_000395 | 3300042591 | Bacteria | 1788 |
| 36 | Ga0466691_126776 | 3300042593 | Unclassified | 1282 |
| 37 | Ga0466699_115927 | 3300042597 | Bacteria | 2226 |
| 38 | Ga0466712_187279 | 3300042614 | Bacteria | 4363 |
| 39 | Ga0466711_152145 | 3300042615 | Bacteria | 2265 |
| 40 | Ga0466711_203784 | 3300042615 | Bacteria | 4743 |
| 41 | Ga0466718_025911 | 3300042617 | Bacteria | 7408 |
| 42 | Ga0466718_050250 | 3300042617 | Bacteria | 1710 |
| 43 | Ga0466719_003352 | 3300042606 | Bacteria | 3043 |
| 44 | Ga0466719_094040 | 3300042606 | Bacteria | 1011 |
| 45 | Ga0466734_042807 | 3300042623 | Bacteria | 1127 |
| 46 | Ga0466703_150740 | 3300042636 | Bacteria | 1759 |
| 47 | Ga0466708_338582 | 3300042652 | Bacteria | 1143 |
| 48 | Ga0123355_10671606 | 3300009826 | Bacteria | 1201 |
| 49 | Ga0123356_12195966 | 3300010049 | Bacteria | 690 |
| 50 | JGI24698J34947_10090853 | 3300002449 | Bacteria | 1402 |
| 51 | JGI24698J34947_10100806 | 3300002449 | Bacteria | 1299 |
| 52 | JGI24695J34938_10139332 | 3300002450 | Bacteria | 991 |
| 53 | Ga0072940_1013968 | 3300005200 | Bacteria | 12019 |
| 54 | Ga0072941_1385777 | 3300005201 | Bacteria | 612 |
| 55 | Ga0466732_455022 | 3300042656 | Bacteria | 2821 |
| 56 | Ga0466690_397878 | 3300042590 | Bacteria | 1055 |
| 57 | Ga0466712_001993 | 3300042614 | Bacteria | 3513 |
| 58 | Ga0466712_109162 | 3300042614 | Bacteria | 6414 |
| 59 | Ga0466711_112634 | 3300042615 | Bacteria | 1463 |
| 60 | Ga0466707_327346 | 3300042601 | Bacteria | 1060 |
| 61 | Ga0466720_176077 | 3300042607 | Bacteria | 1080 |
| 62 | Ga0466721_095967 | 3300042608 | Bacteria | 1187 |
| 63 | Ga0466722_215340 | 3300042609 | Bacteria | 21945 |
| 64 | Ga0466731_113457 | 3300042622 | Bacteria | 1257 |
| 65 | Ga0466731_161732 | 3300042622 | Bacteria | 1088 |
| 66 | Ga0466727_315325 | 3300042655 | Bacteria | 1475 |
| 67 | Ga0123356_11070157 | 3300010049 | Bacteria | 975 |
| 68 | JGI24695J34938_10348128 | 3300002450 | Bacteria | 650 |
| 69 | Ga0072941_1027132 | 3300005201 | Bacteria | 11124 |
| 70 | Ga0466705_049335 | 3300042612 | Bacteria | 4360 |
| 71 | Ga0466733_036137 | 3300042659 | Bacteria | 2511 |
| 72 | Ga0466733_131504 | 3300042659 | Bacteria | 2095 |
| 73 | Ga0264413_106370 | 3300024493 | Bacteria | 27471 |
| 74 | Ga0466691_192336 | 3300042593 | Bacteria | 1083 |
| 75 | Ga0466718_156311 | 3300042617 | Bacteria | 1577 |
| 76 | Ga0466714_142110 | 3300042603 | Bacteria | 3029 |
| 77 | Ga0123353_11381259 | 3300010167 | Bacteria | 907 |
| 78 | AustNasuHG_c1052609 | 3300000089 | Bacteria | 854 |
| 79 | JGI24695J34938_10048756 | 3300002450 | Bacteria | 1864 |
| 80 | Ga0072941_1014769 | 3300005201 | Bacteria | 8908 |
| 81 | Ga0466690_194136 | 3300042590 | Bacteria | 1193 |
| 82 | Ga0466693_384490 | 3300042592 | Bacteria | 1490 |
| 83 | Ga0466718_020155 | 3300042617 | Bacteria | 1007 |
| 84 | Ga0466716_021398 | 3300042605 | Bacteria | 1150 |
| 85 | Ga0466698_289050 | 3300042610 | Bacteria | 1039 |
| 86 | Ga0466731_384086 | 3300042622 | Bacteria | 1150 |
| 87 | Ga0466704_050884 | 3300042643 | Bacteria | 25427 |
| 88 | Ga0466704_288942 | 3300042643 | Bacteria | 3830 |
| 89 | Ga0123356_10023245 | 3300010049 | Bacteria | 5836 |
| 90 | AustNasuHG_c1006727 | 3300000089 | Bacteria | 4099 |
| 91 | Ga0466705_365505 | 3300042612 | Bacteria | 1581 |
| 92 | Ga0466732_027339 | 3300042656 | Bacteria | 1143 |
| 93 | Ga0466733_166717 | 3300042659 | Bacteria | 87248 |
| 94 | Ga0466657_286811 | 3300042582 | Bacteria | 1134 |
| 95 | Ga0466712_014063 | 3300042614 | Bacteria | 2570 |
| 96 | Ga0466718_067103 | 3300042617 | Bacteria | 5922 |
| 97 | Ga0466726_135203 | 3300042619 | Bacteria | 1111 |
| 98 | Ga0466728_046424 | 3300042620 | Bacteria | 14943 |
| 99 | Ga0466717_144866 | 3300042604 | Bacteria | 1040 |
| 100 | Ga0466720_140847 | 3300042607 | Bacteria | 15746 |
| 101 | Ga0466704_306631 | 3300042643 | Bacteria | 7664 |
| 102 | Ga0466704_580798 | 3300042643 | Bacteria | 1036 |
| 103 | Ga0466727_334387 | 3300042655 | Bacteria | 1020 |
| 104 | Ga0123357_10378985 | 3300009784 | Bacteria | 1315 |
| 105 | Ga0123356_13192279 | 3300010049 | Bacteria | 571 |
| 106 | Ga0123353_10837012 | 3300010167 | Bacteria | 1264 |
| 107 | JGI24697J35500_10573569 | 3300002507 | Unclassified | 569 |
| 108 | Ga0466732_127874 | 3300042656 | Bacteria | 3085 |
| 109 | Ga0466691_192804 | 3300042593 | Bacteria | 1689 |
| 110 | Ga0466695_106753 | 3300042595 | Bacteria | 1058 |
| 111 | Ga0466718_035256 | 3300042617 | Bacteria | 30421 |
| 112 | Ga0466723_269095 | 3300042618 | Bacteria | 3788 |
| 113 | Ga0466726_447863 | 3300042619 | Bacteria | 1036 |
| 114 | Ga0466728_238458 | 3300042620 | Bacteria | 3109 |
| 115 | Ga0466703_135479 | 3300042636 | Bacteria | 4580 |
| 116 | Ga0466704_130130 | 3300042643 | Bacteria | 5789 |
| 117 | Ga0466725_445281 | 3300042654 | Bacteria | 1509 |
| 118 | AustNasuHG_c1007117 | 3300000089 | Bacteria | 3986 |
| 119 | JGI24698J34947_10075114 | 3300002449 | Bacteria | 1608 |
| 120 | JGI24698J34947_10143970 | 3300002449 | Bacteria | 1000 |
| 121 | JGI24695J34938_10156720 | 3300002450 | Bacteria | 935 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF20797 | HepT-like_2 | HepT-like protein | 72 | 178 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.