Protein Family IF08555
Metagenome
Isolate
149
Members
64
Samples
126
Scaffolds
354.81
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_252043|Ga0466729_252043_1899_3059
- Length
- 386 aa
- Sequence
- MNTRENRKRQLRFINKTTNVKQKIMMENANRRDFLKTISVAGAAMAAGSLLTSCKSETVPAVTDNQSKWLVPLNQGLKITGTFLDEISHDIPHQNWGEKEWDQDFASMKAIGIDTVILIRSGYRRFITYPSEYLIKKHGCYMPSVDLVDRFLRLADKYGMKFYFGLYDSGKYWDTGDLSWEIEDNKYVIDEVWKNYGFHKSFGGWYISGEISRKTKGAIEAFRAMGQQCKDVSGGLPTFISPWIDGKKAVMASSGQLSKTDAVSVQEHEKEWGEIFDGIKGAVDACAFQDGHIDYDELDAFFEVNKKMAGKYGMQCWTNAESFDRDMPIKFLPIKFDKLRMKLEAAARAGYDKAITFEFSHFMSPQSAYLQAGHLYDRYKEYFQIK
Sample Types
Isolate
14.1%
Metagenome
85.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.2%
Kalotermitidae
22.0%
Unclassified
11.9%
Rhinotermitidae
8.5%
Apidae
6.8%
Blattidae
6.8%
Termopsidae
5.1%
Daphniidae
1.7%
Armadillidiidae
1.7%
Culicidae
1.7%
Passalidae
1.7%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 2 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 3 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 15 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 30 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 31 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 32 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 35 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 36 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 37 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 45 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 46 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 51 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 52 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 53 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 54 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 55 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 56 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 57 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 58 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 59 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_138130 | 3300042615 | Bacteria | 15142 |
| 2 | Ga0466711_377853 | 3300042615 | Bacteria | 2109 |
| 3 | Ga0466711_388295 | 3300042615 | Bacteria | 24101 |
| 4 | Ga0466715_178776 | 3300042616 | Bacteria | 1835 |
| 5 | Ga0466715_364010 | 3300042616 | Unclassified | 2887 |
| 6 | Ga0160467_100017 | 3300012829 | Bacteria | 333132 |
| 7 | Ga0466657_075944 | 3300042582 | Bacteria | 3984 |
| 8 | Ga0466690_261233 | 3300042590 | Bacteria | 20412 |
| 9 | Ga0466692_108025 | 3300042591 | Bacteria | 12787 |
| 10 | Ga0466694_211347 | 3300042594 | Bacteria | 7167 |
| 11 | Ga0466696_082697 | 3300042596 | Bacteria | 6398 |
| 12 | Ga0466729_252043 | 3300042621 | Bacteria | 7050 |
| 13 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 14 | Ga0123353_10385070 | 3300010167 | Bacteria | 2095 |
| 15 | Ga0123354_10013057 | 3300010882 | Bacteria | 12868 |
| 16 | Ga0123354_10019424 | 3300010882 | Bacteria | 10672 |
| 17 | Ga0466713_045544 | 3300042602 | Bacteria | 37734 |
| 18 | Ga0466713_132502 | 3300042602 | Bacteria | 30273 |
| 19 | IMNBL1DRAFT_c0000758 | 3300000062 | Bacteria | 25498 |
| 20 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 21 | Ga0466705_429505 | 3300042612 | Bacteria | 17902 |
| 22 | Ga0466690_050607 | 3300042590 | Bacteria | 2730 |
| 23 | Ga0466692_026125 | 3300042591 | Bacteria | 30408 |
| 24 | Ga0466693_020471 | 3300042592 | Bacteria | 1900 |
| 25 | Ga0466695_209766 | 3300042595 | Bacteria | 1508 |
| 26 | Ga0466703_125134 | 3300042636 | Unclassified | 5181 |
| 27 | Ga0466704_278363 | 3300042643 | Bacteria | 18538 |
| 28 | Ga0466709_097057 | 3300042648 | Bacteria | 50776 |
| 29 | Ga0466727_143132 | 3300042655 | Bacteria | 2341 |
| 30 | Ga0466727_202140 | 3300042655 | Bacteria | 6103 |
| 31 | Ga0123356_10175531 | 3300010049 | Bacteria | 2158 |
| 32 | Ga0123353_10133805 | 3300010167 | Bacteria | 3978 |
| 33 | Ga0123354_10000032 | 3300010882 | Bacteria | 104032 |
| 34 | Ga0466701_022710 | 3300042598 | Bacteria | 2763 |
| 35 | Ga0466714_127007 | 3300042603 | Bacteria | 2419 |
| 36 | Ga0466716_497244 | 3300042605 | Bacteria | 6440 |
| 37 | Ga0466719_006239 | 3300042606 | Bacteria | 2594 |
| 38 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 39 | Ga0466733_133481 | 3300042659 | Bacteria | 7548 |
| 40 | Ga0466733_197111 | 3300042659 | Bacteria | 2111 |
| 41 | Ga0466715_009856 | 3300042616 | Bacteria | 3386 |
| 42 | Ga0466729_046722 | 3300042621 | Bacteria | 1330 |
| 43 | Ga0160460_100041 | 3300012845 | Bacteria | 258343 |
| 44 | Ga0466690_050332 | 3300042590 | Bacteria | 18471 |
| 45 | Ga0466690_241040 | 3300042590 | Bacteria | 2488 |
| 46 | Ga0466696_309857 | 3300042596 | Bacteria | 3445 |
| 47 | Ga0466735_081980 | 3300042624 | Bacteria | 2700 |
| 48 | Ga0466730_086151 | 3300042625 | Bacteria | 3153 |
| 49 | Ga0466704_243226 | 3300042643 | Bacteria | 34984 |
| 50 | Ga0466724_13999 | 3300042649 | Bacteria | 23444 |
| 51 | Ga0123356_10028376 | 3300010049 | Bacteria | 5243 |
| 52 | Ga0123354_10112318 | 3300010882 | Bacteria | 3588 |
| 53 | Ga0466707_028404 | 3300042601 | Bacteria | 11861 |
| 54 | Ga0466713_000924 | 3300042602 | Bacteria | 29055 |
| 55 | Ga0466719_165396 | 3300042606 | Bacteria | 5602 |
| 56 | IMNBL1DRAFT_c0029609 | 3300000062 | Bacteria | 2023 |
| 57 | JGI24702J35022_10002492 | 3300002462 | Bacteria | 11235 |
| 58 | JGI24702J35022_10084020 | 3300002462 | Bacteria | 1727 |
| 59 | Ga0068305_10018466 | 3300005083 | Bacteria | 33580 |
| 60 | Ga0466705_403235 | 3300042612 | Bacteria | 16974 |
| 61 | Ga0466715_297130 | 3300042616 | Bacteria | 17908 |
| 62 | Ga0466691_022141 | 3300042593 | Bacteria | 3426 |
| 63 | Ga0466703_088375 | 3300042636 | Bacteria | 40832 |
| 64 | Ga0466708_276162 | 3300042652 | Bacteria | 4594 |
| 65 | Ga0123356_10541430 | 3300010049 | Bacteria | 1324 |
| 66 | Ga0466714_062720 | 3300042603 | Bacteria | 2633 |
| 67 | JGI24702J35022_10103953 | 3300002462 | Bacteria | 1558 |
| 68 | Ga0466705_147475 | 3300042612 | Bacteria | 7811 |
| 69 | Ga0466710_191909 | 3300042613 | Bacteria | 1254 |
| 70 | Ga0466726_299170 | 3300042619 | Bacteria | 2250 |
| 71 | Ga0466726_473983 | 3300042619 | Bacteria | 1814 |
| 72 | Ga0466690_335034 | 3300042590 | Bacteria | 18270 |
| 73 | Ga0466691_044878 | 3300042593 | Bacteria | 5039 |
| 74 | Ga0466725_210534 | 3300042654 | Bacteria | 19860 |
| 75 | Ga0123356_10186446 | 3300010049 | Unclassified | 2101 |
| 76 | Ga0160464_100142 | 3300012805 | Bacteria | 78675 |
| 77 | Ga0466714_002057 | 3300042603 | Bacteria | 1403 |
| 78 | Ga0466714_072905 | 3300042603 | Bacteria | 26661 |
| 79 | Ga0466722_017995 | 3300042609 | Bacteria | 9703 |
| 80 | Ga0466722_041164 | 3300042609 | Bacteria | 8947 |
| 81 | Ga0466697_050291 | 3300042611 | Bacteria | 3159 |
| 82 | JGI24702J35022_10130243 | 3300002462 | Unclassified | 1396 |
| 83 | Ga0466711_219636 | 3300042615 | Bacteria | 15142 |
| 84 | Ga0466711_502239 | 3300042615 | Bacteria | 21969 |
| 85 | Ga0466726_433623 | 3300042619 | Bacteria | 3950 |
| 86 | Ga0466701_008838 | 3300042598 | Bacteria | 51152 |
| 87 | Ga0466704_443397 | 3300042643 | Bacteria | 15243 |
| 88 | Ga0466709_089117 | 3300042648 | Bacteria | 3516 |
| 89 | Ga0466709_156512 | 3300042648 | Bacteria | 4301 |
| 90 | Ga0466708_180100 | 3300042652 | Bacteria | 18191 |
| 91 | Ga0466727_170261 | 3300042655 | Bacteria | 13452 |
| 92 | Ga0123353_10098383 | 3300010167 | Bacteria | 4715 |
| 93 | Ga0466701_083891 | 3300042598 | Bacteria | 2522 |
| 94 | Ga0466700_338478 | 3300042600 | Bacteria | 37873 |
| 95 | Ga0466698_097095 | 3300042610 | Bacteria | 2852 |
| 96 | Ga0466705_091086 | 3300042612 | Bacteria | 21348 |
| 97 | Ga0466705_153323 | 3300042612 | Bacteria | 11069 |
| 98 | Ga0466733_014441 | 3300042659 | Bacteria | 42619 |
| 99 | Ga0466710_003404 | 3300042613 | Bacteria | 6700 |
| 100 | Ga0466715_276469 | 3300042616 | Bacteria | 41824 |
| 101 | Ga0466692_024510 | 3300042591 | Bacteria | 21613 |
| 102 | Ga0466692_091832 | 3300042591 | Bacteria | 55079 |
| 103 | Ga0466693_278256 | 3300042592 | Bacteria | 1573 |
| 104 | Ga0466734_114087 | 3300042623 | Bacteria | 5751 |
| 105 | Ga0466735_108542 | 3300042624 | Bacteria | 12812 |
| 106 | Ga0466703_060020 | 3300042636 | Bacteria | 14615 |
| 107 | Ga0466709_168950 | 3300042648 | Bacteria | 102495 |
| 108 | Ga0123354_10150785 | 3300010882 | Bacteria | 2817 |
| 109 | Ga0466701_046213 | 3300042598 | Bacteria | 19411 |
| 110 | Ga0466700_376566 | 3300042600 | Bacteria | 7920 |
| 111 | Ga0466719_535910 | 3300042606 | Bacteria | 1993 |
| 112 | Ga0074278_139916 | 3300005721 | Unclassified | 8605 |
| 113 | Ga0466710_014956 | 3300042613 | Bacteria | 24133 |
| 114 | Ga0466715_053183 | 3300042616 | Bacteria | 32898 |
| 115 | Ga0466715_338001 | 3300042616 | Bacteria | 12020 |
| 116 | Ga0466723_054671 | 3300042618 | Bacteria | 4002 |
| 117 | Ga0466726_229716 | 3300042619 | Bacteria | 10708 |
| 118 | Ga0466729_307144 | 3300042621 | Bacteria | 15861 |
| 119 | Ga0466730_048622 | 3300042625 | Unclassified | 3116 |
| 120 | Ga0466709_026512 | 3300042648 | Bacteria | 33059 |
| 121 | Ga0466713_112803 | 3300042602 | Bacteria | 145809 |
| 122 | Ga0466713_123288 | 3300042602 | Bacteria | 76789 |
| 123 | Ga0466716_133565 | 3300042605 | Bacteria | 11841 |
| 124 | Ga0466719_478347 | 3300042606 | Bacteria | 2526 |
| 125 | Ga0466722_040015 | 3300042609 | Bacteria | 18144 |
| 126 | JGI24702J35022_10152062 | 3300002462 | Bacteria | 1299 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14488 | DUF4434 | Domain of unknown function (DUF4434) | 79 | 369 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.