Protein Family IF08539
Metagenome
Isolate
177
Members
50
Samples
168
Scaffolds
136.23
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_201495|Ga0466729_201495_64_531
- Length
- 155 aa
- Sequence
- LRFISRRGIERDEKEMISHRKRNKVKSEINIAPFTDVILVLLIIFMITTPALMQTGIKVNIPKTEVSDSEDSTNIEVLISKEGYVYMDGKQVRDENVEGVMRELVGSNPGKSVVIRGDKTAKYDYVIQFMDKAKKAGATKFALAVENKITPERLR
Sample Types
Isolate
5.1%
Metagenome
94.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.0%
Kalotermitidae
28.0%
Unclassified
24.0%
Termopsidae
8.0%
Rhinotermitidae
6.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 10 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 40 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 44 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 45 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_289827 | 3300042599 | Bacteria | 109227 |
| 2 | Ga0466716_357215 | 3300042605 | Unclassified | 4550 |
| 3 | Ga0466722_133816 | 3300042609 | Bacteria | 1086 |
| 4 | Ga0123356_11006463 | 3300010049 | Bacteria | 1003 |
| 5 | Ga0123356_13104855 | 3300010049 | Bacteria | 579 |
| 6 | Ga0123353_12192689 | 3300010167 | Bacteria | 669 |
| 7 | Ga0466690_156500 | 3300042590 | Bacteria | 5113 |
| 8 | Ga0466693_042303 | 3300042592 | Unclassified | 2028 |
| 9 | Ga0466696_339052 | 3300042596 | Bacteria | 2961 |
| 10 | Ga0068302_10006822 | 3300005071 | Bacteria | 11449 |
| 11 | Ga0068302_10112725 | 3300005071 | Bacteria | 896 |
| 12 | Ga0466711_145386 | 3300042615 | Bacteria | 7652 |
| 13 | Ga0466711_152211 | 3300042615 | Bacteria | 31595 |
| 14 | Ga0466726_065940 | 3300042619 | Bacteria | 154230 |
| 15 | Ga0466726_120557 | 3300042619 | Bacteria | 27561 |
| 16 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 17 | Ga0466728_070494 | 3300042620 | Bacteria | 11218 |
| 18 | Ga0466729_144661 | 3300042621 | Bacteria | 69198 |
| 19 | Ga0466729_163383 | 3300042621 | Bacteria | 3267 |
| 20 | Ga0466729_185786 | 3300042621 | Bacteria | 54149 |
| 21 | Ga0466697_215741 | 3300042611 | Bacteria | 1316 |
| 22 | Ga0466735_018297 | 3300042624 | Bacteria | 7023 |
| 23 | Ga0466704_055753 | 3300042643 | Unclassified | 5917 |
| 24 | Ga0466704_086571 | 3300042643 | Bacteria | 65985 |
| 25 | Ga0466704_115207 | 3300042643 | Bacteria | 3549 |
| 26 | Ga0466704_282286 | 3300042643 | Bacteria | 7713 |
| 27 | Ga0466704_289907 | 3300042643 | Bacteria | 2256 |
| 28 | Ga0466708_054140 | 3300042652 | Bacteria | 4506 |
| 29 | Ga0466727_063582 | 3300042655 | Bacteria | 93834 |
| 30 | Ga0466727_233754 | 3300042655 | Bacteria | 8682 |
| 31 | Ga0466707_127045 | 3300042601 | Bacteria | 82449 |
| 32 | Ga0466722_082840 | 3300042609 | Bacteria | 1017 |
| 33 | Ga0123357_10013440 | 3300009784 | Bacteria | 10631 |
| 34 | Ga0123353_10679989 | 3300010167 | Bacteria | 1450 |
| 35 | JGI24702J35022_10067638 | 3300002462 | Bacteria | 1919 |
| 36 | JGI24705J35276_12107181 | 3300002504 | Bacteria | 1033 |
| 37 | Ga0466711_364085 | 3300042615 | Bacteria | 228323 |
| 38 | Ga0466715_295478 | 3300042616 | Bacteria | 21788 |
| 39 | Ga0466715_456889 | 3300042616 | Bacteria | 238254 |
| 40 | Ga0466718_043751 | 3300042617 | Bacteria | 2940 |
| 41 | Ga0466726_277719 | 3300042619 | Bacteria | 6302 |
| 42 | Ga0466728_003045 | 3300042620 | Bacteria | 90142 |
| 43 | Ga0466705_010260 | 3300042612 | Bacteria | 28729 |
| 44 | Ga0466735_042877 | 3300042624 | Bacteria | 7185 |
| 45 | Ga0466735_049729 | 3300042624 | Bacteria | 5229 |
| 46 | Ga0466704_342819 | 3300042643 | Bacteria | 15146 |
| 47 | Ga0466707_389959 | 3300042601 | Bacteria | 8268 |
| 48 | Ga0466716_098485 | 3300042605 | Bacteria | 20384 |
| 49 | Ga0466716_209896 | 3300042605 | Bacteria | 12981 |
| 50 | Ga0466719_033732 | 3300042606 | Bacteria | 51056 |
| 51 | Ga0466719_554939 | 3300042606 | Bacteria | 1204 |
| 52 | Ga0123357_10015410 | 3300009784 | Bacteria | 10021 |
| 53 | Ga0123353_12693291 | 3300010167 | Bacteria | 586 |
| 54 | Ga0123354_10000748 | 3300010882 | Bacteria | 35102 |
| 55 | Ga0415639_147921 | 3300038395 | Bacteria | 1314 |
| 56 | Ga0466690_027505 | 3300042590 | Bacteria | 56259 |
| 57 | Ga0466690_101991 | 3300042590 | Bacteria | 1967 |
| 58 | Ga0466690_242150 | 3300042590 | Unclassified | 8290 |
| 59 | Ga0072940_1288170 | 3300005200 | Bacteria | 2634 |
| 60 | Ga0466715_413339 | 3300042616 | Bacteria | 1242 |
| 61 | Ga0466723_044138 | 3300042618 | Bacteria | 29975 |
| 62 | Ga0466723_057339 | 3300042618 | Bacteria | 10507 |
| 63 | Ga0466723_340993 | 3300042618 | Bacteria | 15016 |
| 64 | Ga0466726_178932 | 3300042619 | Bacteria | 2076 |
| 65 | Ga0466728_202244 | 3300042620 | Bacteria | 3933 |
| 66 | Ga0466728_242282 | 3300042620 | Bacteria | 6876 |
| 67 | Ga0466705_321631 | 3300042612 | Bacteria | 270475 |
| 68 | Ga0466735_002657 | 3300042624 | Bacteria | 16445 |
| 69 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 70 | Ga0466706_201378 | 3300042599 | Bacteria | 153801 |
| 71 | Ga0466707_033139 | 3300042601 | Bacteria | 30376 |
| 72 | Ga0466707_332248 | 3300042601 | Bacteria | 3297 |
| 73 | Ga0466716_195853 | 3300042605 | Bacteria | 5222 |
| 74 | Ga0466719_448533 | 3300042606 | Bacteria | 23046 |
| 75 | Ga0466719_528194 | 3300042606 | Bacteria | 1537 |
| 76 | Ga0466722_220598 | 3300042609 | Bacteria | 5878 |
| 77 | Ga0466693_004759 | 3300042592 | Bacteria | 1872 |
| 78 | Ga0466691_015920 | 3300042593 | Bacteria | 62881 |
| 79 | Ga0466691_070979 | 3300042593 | Bacteria | 1434 |
| 80 | Ga0466696_481145 | 3300042596 | Bacteria | 1913 |
| 81 | JGI24705J35276_11737063 | 3300002504 | Bacteria | 650 |
| 82 | Ga0068305_10000952 | 3300005083 | Unclassified | 25120 |
| 83 | Ga0068305_10002148 | 3300005083 | Bacteria | 36971 |
| 84 | Ga0466711_392920 | 3300042615 | Unclassified | 2950 |
| 85 | Ga0466715_065350 | 3300042616 | Bacteria | 64817 |
| 86 | Ga0466718_159804 | 3300042617 | Bacteria | 1755 |
| 87 | Ga0466723_156216 | 3300042618 | Bacteria | 1205 |
| 88 | Ga0466723_253127 | 3300042618 | Unclassified | 5554 |
| 89 | Ga0466734_115389 | 3300042623 | Bacteria | 1989 |
| 90 | Ga0466704_393600 | 3300042643 | Bacteria | 37761 |
| 91 | Ga0466709_233182 | 3300042648 | Bacteria | 91749 |
| 92 | Ga0466713_091719 | 3300042602 | Bacteria | 33782 |
| 93 | Ga0466713_152566 | 3300042602 | Bacteria | 4442 |
| 94 | Ga0466717_299120 | 3300042604 | Bacteria | 1401 |
| 95 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 96 | Ga0123356_11244679 | 3300010049 | Bacteria | 909 |
| 97 | Ga0123354_10170414 | 3300010882 | Unclassified | 2537 |
| 98 | Ga0466690_032268 | 3300042590 | Bacteria | 50751 |
| 99 | Ga0466692_068168 | 3300042591 | Bacteria | 4909 |
| 100 | JGI24702J35022_10379797 | 3300002462 | Bacteria | 850 |
| 101 | Ga0466711_121425 | 3300042615 | Bacteria | 22557 |
| 102 | Ga0466723_151617 | 3300042618 | Bacteria | 21440 |
| 103 | Ga0466726_039990 | 3300042619 | Bacteria | 1033 |
| 104 | Ga0466729_234003 | 3300042621 | Bacteria | 18738 |
| 105 | Ga0466735_001506 | 3300042624 | Bacteria | 12776 |
| 106 | Ga0466735_156753 | 3300042624 | Bacteria | 18748 |
| 107 | Ga0466727_274431 | 3300042655 | Bacteria | 5346 |
| 108 | Ga0466707_040073 | 3300042601 | Bacteria | 3226 |
| 109 | Ga0466707_118305 | 3300042601 | Bacteria | 74695 |
| 110 | Ga0466714_115063 | 3300042603 | Bacteria | 30928 |
| 111 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 112 | Ga0466722_140062 | 3300042609 | Bacteria | 1365 |
| 113 | Ga0123356_11751776 | 3300010049 | Bacteria | 771 |
| 114 | Ga0123353_10275557 | 3300010167 | Bacteria | 2588 |
| 115 | Ga0466690_052321 | 3300042590 | Bacteria | 2813 |
| 116 | JGI24705J35276_12238722 | 3300002504 | Bacteria | 45057 |
| 117 | Ga0068305_10000238 | 3300005083 | Bacteria | 19789 |
| 118 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 119 | Ga0466715_253178 | 3300042616 | Bacteria | 66046 |
| 120 | Ga0466715_281005 | 3300042616 | Bacteria | 20176 |
| 121 | Ga0466715_358711 | 3300042616 | Bacteria | 2056 |
| 122 | Ga0466723_090783 | 3300042618 | Bacteria | 5551 |
| 123 | Ga0466726_158203 | 3300042619 | Unclassified | 3210 |
| 124 | Ga0466726_305334 | 3300042619 | Bacteria | 10609 |
| 125 | Ga0466726_465782 | 3300042619 | Unclassified | 1031 |
| 126 | Ga0466729_173344 | 3300042621 | Unclassified | 2011 |
| 127 | Ga0466705_118909 | 3300042612 | Bacteria | 3048 |
| 128 | Ga0466735_060411 | 3300042624 | Bacteria | 39440 |
| 129 | Ga0466735_093903 | 3300042624 | Bacteria | 3490 |
| 130 | Ga0466735_144396 | 3300042624 | Bacteria | 3917 |
| 131 | Ga0466735_154516 | 3300042624 | Bacteria | 23321 |
| 132 | Ga0466703_205020 | 3300042636 | Bacteria | 117626 |
| 133 | Ga0466704_271090 | 3300042643 | Unclassified | 2346 |
| 134 | Ga0466706_021589 | 3300042599 | Bacteria | 27008 |
| 135 | Ga0466713_141549 | 3300042602 | Bacteria | 78387 |
| 136 | Ga0466722_045970 | 3300042609 | Unclassified | 6638 |
| 137 | Ga0123356_10000388 | 3300010049 | Bacteria | 50176 |
| 138 | Ga0466696_448845 | 3300042596 | Unclassified | 25079 |
| 139 | Ga0068305_10000781 | 3300005083 | Unclassified | 13270 |
| 140 | Ga0068305_10001180 | 3300005083 | Bacteria | 75152 |
| 141 | Ga0466711_253837 | 3300042615 | Unclassified | 25312 |
| 142 | Ga0466715_297517 | 3300042616 | Bacteria | 34381 |
| 143 | Ga0466726_328462 | 3300042619 | Unclassified | 8131 |
| 144 | Ga0466735_009478 | 3300042624 | Bacteria | 6970 |
| 145 | Ga0466735_009848 | 3300042624 | Bacteria | 11730 |
| 146 | Ga0466735_010182 | 3300042624 | Bacteria | 31606 |
| 147 | Ga0466735_112509 | 3300042624 | Bacteria | 17981 |
| 148 | Ga0466735_124124 | 3300042624 | Bacteria | 17422 |
| 149 | Ga0466703_178972 | 3300042636 | Unclassified | 135766 |
| 150 | Ga0466704_370727 | 3300042643 | Bacteria | 76606 |
| 151 | Ga0466727_151432 | 3300042655 | Bacteria | 242508 |
| 152 | Ga0466706_187161 | 3300042599 | Bacteria | 2023 |
| 153 | Ga0466700_431315 | 3300042600 | Bacteria | 8511 |
| 154 | Ga0466707_075711 | 3300042601 | Bacteria | 7256 |
| 155 | Ga0123356_10704965 | 3300010049 | Bacteria | 1178 |
| 156 | Ga0123356_11942672 | 3300010049 | Bacteria | 733 |
| 157 | Ga0466690_200009 | 3300042590 | Bacteria | 1913 |
| 158 | Ga0466692_109256 | 3300042591 | Bacteria | 5383 |
| 159 | Ga0466694_385478 | 3300042594 | Bacteria | 3188 |
| 160 | Ga0466696_230814 | 3300042596 | Bacteria | 13001 |
| 161 | JGI24702J35022_10000399 | 3300002462 | Bacteria | 25810 |
| 162 | JGI24702J35022_10204399 | 3300002462 | Bacteria | 1132 |
| 163 | Ga0068302_10343611 | 3300005071 | Bacteria | 3194 |
| 164 | Ga0466705_390626 | 3300042612 | Bacteria | 1414 |
| 165 | Ga0466705_218757 | 3300042612 | Unclassified | 2453 |
| 166 | Ga0466729_201495 | 3300042621 | Bacteria | 1924 |
| 167 | Ga0466704_455909 | 3300042643 | Unclassified | 2631 |
| 168 | Ga0466727_226644 | 3300042655 | Bacteria | 4612 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 25 | 147 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.