Protein Family IF08521
Metagenome
Isolate
156
Members
54
Samples
144
Scaffolds
235.74
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_149836|Ga0466729_149836_208_1059
- Length
- 283 aa
- Sequence
- VPGLFSGRTFGTKTAAPPAGSAVPFCGDFLLRSVPVRRCSRRYGNGDRQGNIIIALRNVSARYPDGTAALENISFDAAAGENVALVGANGAGKTSLLLAMVGILPVSSGTITIDGVELGPKTLEELRRRTGLVFQNPDDQLFMPSIYEDLAFGPRNMALAEDEVSRRVDEALAALGITRLRDRSSLKLSGGEKRLTAIATVLTMRPAVMLFDEPTAFLDPRSRRSLITVLQSLPHTKLIATHDLAFAAEICGRALVLKDGALCAQGPTAELFQDGELMEKCGL
Sample Types
Isolate
7.7%
Metagenome
92.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.0%
Unclassified
28.3%
Kalotermitidae
26.4%
Termopsidae
7.5%
Rhinotermitidae
3.8%
Taxonomy
Archaea
0
Bacteria
156
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 2 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 19 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 20 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 21 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 22 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 36 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10000084 | 3300002462 | Bacteria | 41780 |
| 2 | Ga0068302_10599755 | 3300005071 | Bacteria | 1083 |
| 3 | Ga0123356_10081500 | 3300010049 | Bacteria | 3061 |
| 4 | Ga0123356_10159067 | 3300010049 | Bacteria | 2254 |
| 5 | Ga0123356_10404007 | 3300010049 | Bacteria | 1504 |
| 6 | Ga0123356_11037424 | 3300010049 | Bacteria | 990 |
| 7 | Ga0123353_10207796 | 3300010167 | Bacteria | 3073 |
| 8 | Ga0123353_10676967 | 3300010167 | Bacteria | 1454 |
| 9 | Ga0123353_11195896 | 3300010167 | Bacteria | 998 |
| 10 | Ga0466707_399757 | 3300042601 | Bacteria | 5091 |
| 11 | Ga0466719_093224 | 3300042606 | Bacteria | 19583 |
| 12 | Ga0466735_213291 | 3300042624 | Bacteria | 1102 |
| 13 | Ga0466709_417827 | 3300042648 | Bacteria | 1260 |
| 14 | Ga0466727_147300 | 3300042655 | Bacteria | 4584 |
| 15 | Ga0466727_315442 | 3300042655 | Bacteria | 1560 |
| 16 | Ga0466711_105020 | 3300042615 | Bacteria | 3249 |
| 17 | Ga0466711_348012 | 3300042615 | Bacteria | 3301 |
| 18 | Ga0466711_427539 | 3300042615 | Bacteria | 16703 |
| 19 | Ga0466726_169665 | 3300042619 | Bacteria | 1267 |
| 20 | Ga0466726_256221 | 3300042619 | Bacteria | 3029 |
| 21 | Ga0466691_037601 | 3300042593 | Bacteria | 1342 |
| 22 | Ga0466696_380343 | 3300042596 | Bacteria | 11454 |
| 23 | Ga0068305_10054023 | 3300005083 | Bacteria | 8332 |
| 24 | Ga0123356_10149758 | 3300010049 | Bacteria | 2315 |
| 25 | Ga0123353_10032331 | 3300010167 | Bacteria | 8123 |
| 26 | Ga0123353_10148811 | 3300010167 | Bacteria | 3741 |
| 27 | Ga0123353_10324524 | 3300010167 | Bacteria | 2334 |
| 28 | Ga0466707_053062 | 3300042601 | Bacteria | 1003 |
| 29 | Ga0466707_185897 | 3300042601 | Bacteria | 4514 |
| 30 | Ga0466707_410309 | 3300042601 | Bacteria | 2712 |
| 31 | Ga0466716_022592 | 3300042605 | Bacteria | 5973 |
| 32 | Ga0466716_099092 | 3300042605 | Bacteria | 24869 |
| 33 | Ga0466719_072019 | 3300042606 | Bacteria | 2833 |
| 34 | Ga0466719_226480 | 3300042606 | Bacteria | 9189 |
| 35 | Ga0466727_066717 | 3300042655 | Bacteria | 1575 |
| 36 | Ga0466727_308758 | 3300042655 | Bacteria | 1048 |
| 37 | Ga0466715_221262 | 3300042616 | Bacteria | 3981 |
| 38 | Ga0466715_395735 | 3300042616 | Bacteria | 16931 |
| 39 | Ga0466718_162405 | 3300042617 | Bacteria | 3173 |
| 40 | Ga0466723_156215 | 3300042618 | Bacteria | 4920 |
| 41 | Ga0466726_427280 | 3300042619 | Bacteria | 3850 |
| 42 | Ga0466726_454144 | 3300042619 | Bacteria | 15087 |
| 43 | Ga0466691_094514 | 3300042593 | Bacteria | 9254 |
| 44 | Ga0466733_109240 | 3300042659 | Bacteria | 2136 |
| 45 | Ga0123356_10329480 | 3300010049 | Bacteria | 1643 |
| 46 | Ga0123356_10520031 | 3300010049 | Bacteria | 1348 |
| 47 | Ga0123353_10008728 | 3300010167 | Bacteria | 13880 |
| 48 | Ga0123353_10121876 | 3300010167 | Bacteria | 4192 |
| 49 | Ga0466707_173946 | 3300042601 | Bacteria | 3767 |
| 50 | Ga0466704_294287 | 3300042643 | Bacteria | 14489 |
| 51 | Ga0466708_313893 | 3300042652 | Bacteria | 2285 |
| 52 | Ga0466727_249447 | 3300042655 | Bacteria | 1714 |
| 53 | Ga0466727_331066 | 3300042655 | Bacteria | 1468 |
| 54 | Ga0466711_390004 | 3300042615 | Bacteria | 20738 |
| 55 | Ga0466715_071063 | 3300042616 | Bacteria | 6500 |
| 56 | Ga0466728_070402 | 3300042620 | Bacteria | 2478 |
| 57 | Ga0466693_264522 | 3300042592 | Bacteria | 1781 |
| 58 | Ga0466691_046402 | 3300042593 | Bacteria | 6781 |
| 59 | Ga0123353_10697338 | 3300010167 | Bacteria | 1426 |
| 60 | Ga0466707_294094 | 3300042601 | Bacteria | 1030 |
| 61 | Ga0466719_117676 | 3300042606 | Bacteria | 7654 |
| 62 | Ga0466722_075354 | 3300042609 | Bacteria | 2175 |
| 63 | Ga0466735_161897 | 3300042624 | Bacteria | 1159 |
| 64 | Ga0466702_202946 | 3300042635 | Bacteria | 1889 |
| 65 | Ga0466727_088348 | 3300042655 | Bacteria | 1780 |
| 66 | Ga0466727_222497 | 3300042655 | Bacteria | 2976 |
| 67 | Ga0466715_388849 | 3300042616 | Bacteria | 3975 |
| 68 | Ga0466723_062742 | 3300042618 | Bacteria | 5532 |
| 69 | Ga0466726_046233 | 3300042619 | Bacteria | 4965 |
| 70 | Ga0466657_318098 | 3300042582 | Bacteria | 1760 |
| 71 | Ga0466693_288682 | 3300042592 | Bacteria | 1026 |
| 72 | Ga0466691_018680 | 3300042593 | Bacteria | 16518 |
| 73 | Ga0466691_164369 | 3300042593 | Bacteria | 15909 |
| 74 | Ga0466694_003877 | 3300042594 | Bacteria | 5883 |
| 75 | Ga0466696_504313 | 3300042596 | Bacteria | 5554 |
| 76 | JGI24705J35276_12237667 | 3300002504 | Bacteria | 12400 |
| 77 | Ga0072941_1041958 | 3300005201 | Bacteria | 3960 |
| 78 | Ga0123356_10037218 | 3300010049 | Bacteria | 4541 |
| 79 | Ga0123353_10000632 | 3300010167 | Bacteria | 43003 |
| 80 | Ga0123353_10093411 | 3300010167 | Bacteria | 4847 |
| 81 | Ga0123353_10365635 | 3300010167 | Bacteria | 2165 |
| 82 | Ga0123353_10420337 | 3300010167 | Bacteria | 1981 |
| 83 | Ga0123353_11532875 | 3300010167 | Bacteria | 847 |
| 84 | Ga0466713_108925 | 3300042602 | Bacteria | 1566 |
| 85 | Ga0466716_052123 | 3300042605 | Bacteria | 1240 |
| 86 | Ga0466708_035150 | 3300042652 | Bacteria | 6489 |
| 87 | Ga0466727_336005 | 3300042655 | Bacteria | 2731 |
| 88 | Ga0466715_405495 | 3300042616 | Bacteria | 12499 |
| 89 | Ga0466723_322820 | 3300042618 | Bacteria | 1923 |
| 90 | Ga0466726_143184 | 3300042619 | Bacteria | 21443 |
| 91 | Ga0466726_400453 | 3300042619 | Bacteria | 1418 |
| 92 | Ga0466726_429737 | 3300042619 | Bacteria | 1040 |
| 93 | Ga0466726_456163 | 3300042619 | Bacteria | 1647 |
| 94 | Ga0466690_006073 | 3300042590 | Bacteria | 2371 |
| 95 | Ga0466693_121857 | 3300042592 | Bacteria | 33009 |
| 96 | Ga0466691_167138 | 3300042593 | Bacteria | 1861 |
| 97 | Ga0466699_014691 | 3300042597 | Bacteria | 3235 |
| 98 | JGI24702J35022_10056700 | 3300002462 | Bacteria | 2090 |
| 99 | JGI24705J35276_12202024 | 3300002504 | Bacteria | 1629 |
| 100 | Ga0466705_053258 | 3300042612 | Bacteria | 7890 |
| 101 | Ga0123357_10090537 | 3300009784 | Bacteria | 3990 |
| 102 | Ga0123356_10096832 | 3300010049 | Bacteria | 2822 |
| 103 | Ga0123353_11236125 | 3300010167 | Bacteria | 976 |
| 104 | Ga0466717_084416 | 3300042604 | Bacteria | 4176 |
| 105 | Ga0466722_217706 | 3300042609 | Bacteria | 3293 |
| 106 | Ga0466731_195057 | 3300042622 | Bacteria | 1252 |
| 107 | Ga0466735_148475 | 3300042624 | Bacteria | 1548 |
| 108 | Ga0466735_179452 | 3300042624 | Bacteria | 3400 |
| 109 | Ga0466704_273786 | 3300042643 | Bacteria | 4279 |
| 110 | Ga0466709_046013 | 3300042648 | Bacteria | 5560 |
| 111 | Ga0466726_106363 | 3300042619 | Bacteria | 1347 |
| 112 | Ga0466729_149836 | 3300042621 | Bacteria | 1099 |
| 113 | Ga0466690_330522 | 3300042590 | Bacteria | 1382 |
| 114 | Ga0466694_315773 | 3300042594 | Bacteria | 3418 |
| 115 | Ga0466694_358402 | 3300042594 | Bacteria | 3166 |
| 116 | JGI24702J35022_10008357 | 3300002462 | Bacteria | 5862 |
| 117 | JGI24705J35276_12238306 | 3300002504 | Bacteria | 18999 |
| 118 | Ga0466705_035079 | 3300042612 | Bacteria | 4687 |
| 119 | Ga0123355_10761754 | 3300009826 | Bacteria | 1091 |
| 120 | Ga0123356_10641356 | 3300010049 | Bacteria | 1229 |
| 121 | Ga0123353_10370085 | 3300010167 | Bacteria | 2149 |
| 122 | Ga0466700_058028 | 3300042600 | Bacteria | 4477 |
| 123 | Ga0466707_008060 | 3300042601 | Bacteria | 10332 |
| 124 | Ga0466725_227824 | 3300042654 | Bacteria | 3404 |
| 125 | Ga0466715_206321 | 3300042616 | Bacteria | 11035 |
| 126 | Ga0466723_094842 | 3300042618 | Bacteria | 1891 |
| 127 | Ga0466726_347567 | 3300042619 | Bacteria | 1308 |
| 128 | Ga0466728_108055 | 3300042620 | Bacteria | 1451 |
| 129 | JGI24702J35022_10117663 | 3300002462 | Bacteria | 1466 |
| 130 | Ga0466705_201484 | 3300042612 | Bacteria | 5957 |
| 131 | Ga0123353_10048629 | 3300010167 | Bacteria | 6754 |
| 132 | Ga0123353_10554284 | 3300010167 | Bacteria | 1657 |
| 133 | Ga0123354_10117819 | 3300010882 | Bacteria | 3453 |
| 134 | Ga0466717_307883 | 3300042604 | Bacteria | 1488 |
| 135 | Ga0466703_338918 | 3300042636 | Bacteria | 2357 |
| 136 | Ga0466708_261813 | 3300042652 | Bacteria | 8277 |
| 137 | Ga0466708_339681 | 3300042652 | Bacteria | 11941 |
| 138 | Ga0466727_128420 | 3300042655 | Bacteria | 5400 |
| 139 | Ga0466727_273622 | 3300042655 | Bacteria | 8414 |
| 140 | Ga0466711_164763 | 3300042615 | Bacteria | 14260 |
| 141 | Ga0466715_447997 | 3300042616 | Bacteria | 14183 |
| 142 | Ga0466715_520186 | 3300042616 | Bacteria | 3296 |
| 143 | Ga0466728_070604 | 3300042620 | Bacteria | 4868 |
| 144 | Ga0466729_014239 | 3300042621 | Bacteria | 10584 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.