Protein Family IF08518
Metagenome
Isolate
104
Members
41
Samples
101
Scaffolds
129.17
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_145464|Ga0466729_145464_746_1195
- Length
- 149 aa
- Sequence
- VLYHDNYLRSVKTEELKTQGVLMKGKFPLKPFDFAVIGLSAALTAFSAFMIYAKPQNTQQVMIRGSGKVWVFPLDAEETVTVPGPLGDTVVEIRNHQAHVVSSPCENQTCVAAGHIDSGGQWVACLPNKVFVVIEGKDDINEYIDSAVW
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.9%
Kalotermitidae
35.9%
Unclassified
10.3%
Rhinotermitidae
10.3%
Termopsidae
7.7%
Taxonomy
Archaea
1
Bacteria
97
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 21 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 22 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 31 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_048633 | 3300042612 | Bacteria | 2091 |
| 2 | Ga0456237_0007247 | 3300041968 | Bacteria | 1714 |
| 3 | Ga0466691_008800 | 3300042593 | Bacteria | 15279 |
| 4 | Ga0466696_405127 | 3300042596 | Unclassified | 1394 |
| 5 | Ga0466709_166450 | 3300042648 | Bacteria | 2102 |
| 6 | Ga0466719_011756 | 3300042606 | Bacteria | 2116 |
| 7 | Ga0466719_138010 | 3300042606 | Bacteria | 22276 |
| 8 | Ga0466719_276366 | 3300042606 | Bacteria | 3538 |
| 9 | Ga0466720_182713 | 3300042607 | Bacteria | 13011 |
| 10 | Ga0466722_046577 | 3300042609 | Bacteria | 3762 |
| 11 | Ga0466711_388720 | 3300042615 | Bacteria | 13691 |
| 12 | Ga0466690_120587 | 3300042590 | Unclassified | 1215 |
| 13 | Ga0466691_006370 | 3300042593 | Bacteria | 22207 |
| 14 | Ga0466696_043779 | 3300042596 | Bacteria | 13154 |
| 15 | Ga0466696_397462 | 3300042596 | Bacteria | 14126 |
| 16 | Ga0466729_252976 | 3300042621 | Bacteria | 1336 |
| 17 | Ga0466702_356661 | 3300042635 | Bacteria | 10748 |
| 18 | Ga0466707_106609 | 3300042601 | Bacteria | 1054 |
| 19 | Ga0466707_211947 | 3300042601 | Bacteria | 1079 |
| 20 | Ga0466707_328603 | 3300042601 | Bacteria | 1108 |
| 21 | Ga0466707_388320 | 3300042601 | Bacteria | 1916 |
| 22 | Ga0466716_027622 | 3300042605 | Bacteria | 1151 |
| 23 | Ga0466719_426634 | 3300042606 | Bacteria | 3498 |
| 24 | Ga0466722_065413 | 3300042609 | Bacteria | 16692 |
| 25 | Ga0466705_525672 | 3300042612 | Bacteria | 4421 |
| 26 | Ga0466729_145464 | 3300042621 | Bacteria | 1212 |
| 27 | Ga0466692_185498 | 3300042591 | Bacteria | 3158 |
| 28 | Ga0466734_026805 | 3300042623 | Bacteria | 1323 |
| 29 | Ga0466708_044952 | 3300042652 | Bacteria | 7370 |
| 30 | Ga0466719_101605 | 3300042606 | Bacteria | 1493 |
| 31 | Ga0466719_322905 | 3300042606 | Bacteria | 1599 |
| 32 | JGI24695J34938_10000045 | 3300002450 | Bacteria | 92650 |
| 33 | Ga0466715_272365 | 3300042616 | Bacteria | 50899 |
| 34 | Ga0466723_127902 | 3300042618 | Bacteria | 9645 |
| 35 | Ga0466723_303372 | 3300042618 | Unclassified | 4199 |
| 36 | Ga0466728_084889 | 3300042620 | Bacteria | 6722 |
| 37 | Ga0466696_222674 | 3300042596 | Bacteria | 10897 |
| 38 | Ga0466704_556679 | 3300042643 | Bacteria | 57080 |
| 39 | Ga0466708_242105 | 3300042652 | Bacteria | 5247 |
| 40 | Ga0466719_479714 | 3300042606 | Bacteria | 2991 |
| 41 | JGI24698J34947_10245477 | 3300002449 | Bacteria | 672 |
| 42 | JGI24695J34938_10002765 | 3300002450 | Bacteria | 12886 |
| 43 | Ga0466715_052191 | 3300042616 | Unclassified | 1679 |
| 44 | Ga0466728_096261 | 3300042620 | Bacteria | 4443 |
| 45 | Ga0123357_10224609 | 3300009784 | Bacteria | 2075 |
| 46 | Ga0123356_10069826 | 3300010049 | Bacteria | 3295 |
| 47 | Ga0123356_10741535 | 3300010049 | Bacteria | 1152 |
| 48 | Ga0123356_11392337 | 3300010049 | Bacteria | 862 |
| 49 | Ga0123353_10133562 | 3300010167 | Bacteria | 3982 |
| 50 | Ga0123354_10116322 | 3300010882 | Bacteria | 3488 |
| 51 | Ga0264413_126433 | 3300024493 | Bacteria | 995 |
| 52 | Ga0466691_037337 | 3300042593 | Bacteria | 3764 |
| 53 | Ga0466704_122062 | 3300042643 | Bacteria | 2487 |
| 54 | Ga0466704_237753 | 3300042643 | Bacteria | 2498 |
| 55 | Ga0466709_297419 | 3300042648 | Bacteria | 6613 |
| 56 | Ga0466727_251165 | 3300042655 | Bacteria | 1024 |
| 57 | Ga0466727_262404 | 3300042655 | Bacteria | 1213 |
| 58 | Ga0466707_422332 | 3300042601 | Bacteria | 1169 |
| 59 | Ga0466716_077109 | 3300042605 | Bacteria | 5502 |
| 60 | Ga0466716_092526 | 3300042605 | Bacteria | 7111 |
| 61 | AustNasuHG_c1058856 | 3300000089 | Bacteria | 757 |
| 62 | JGI24698J34947_10235129 | 3300002449 | Unclassified | 694 |
| 63 | Ga0466712_029829 | 3300042614 | Bacteria | 1294 |
| 64 | Ga0466726_113349 | 3300042619 | Bacteria | 2424 |
| 65 | Ga0466726_295455 | 3300042619 | Bacteria | 2255 |
| 66 | Ga0466705_089578 | 3300042612 | Bacteria | 4024 |
| 67 | Ga0123356_10003253 | 3300010049 | Bacteria | 17062 |
| 68 | Ga0466694_071663 | 3300042594 | Bacteria | 9227 |
| 69 | Ga0466735_147042 | 3300042624 | Bacteria | 1315 |
| 70 | Ga0466703_112596 | 3300042636 | Bacteria | 7676 |
| 71 | Ga0466719_159189 | 3300042606 | Bacteria | 11394 |
| 72 | Ga0466719_372818 | 3300042606 | Bacteria | 2555 |
| 73 | Ga0466711_101414 | 3300042615 | Bacteria | 3811 |
| 74 | Ga0466715_572743 | 3300042616 | Bacteria | 1334 |
| 75 | Ga0466726_026017 | 3300042619 | Bacteria | 4564 |
| 76 | Ga0123353_11835586 | 3300010167 | Bacteria | 751 |
| 77 | Ga0466690_127079 | 3300042590 | Archaea | 1056 |
| 78 | Ga0466708_306481 | 3300042652 | Bacteria | 3070 |
| 79 | Ga0466727_243152 | 3300042655 | Bacteria | 2657 |
| 80 | Ga0466707_324490 | 3300042601 | Bacteria | 1136 |
| 81 | Ga0466716_044054 | 3300042605 | Bacteria | 3673 |
| 82 | Ga0466716_306771 | 3300042605 | Bacteria | 1050 |
| 83 | AustNasuHG_c1009855 | 3300000089 | Unclassified | 3343 |
| 84 | Ga0466723_200749 | 3300042618 | Bacteria | 72306 |
| 85 | Ga0466705_026371 | 3300042612 | Bacteria | 1224 |
| 86 | Ga0123356_10008812 | 3300010049 | Bacteria | 9995 |
| 87 | Ga0123356_12061657 | 3300010049 | Bacteria | 712 |
| 88 | Ga0466690_145942 | 3300042590 | Bacteria | 6705 |
| 89 | Ga0466692_088326 | 3300042591 | Bacteria | 10310 |
| 90 | Ga0466696_013860 | 3300042596 | Bacteria | 13565 |
| 91 | Ga0466696_163425 | 3300042596 | Bacteria | 2168 |
| 92 | Ga0466699_234238 | 3300042597 | Bacteria | 37498 |
| 93 | Ga0466735_011845 | 3300042624 | Bacteria | 1521 |
| 94 | Ga0466735_235685 | 3300042624 | Bacteria | 2396 |
| 95 | Ga0466703_398272 | 3300042636 | Bacteria | 11961 |
| 96 | Ga0466704_461824 | 3300042643 | Bacteria | 3985 |
| 97 | Ga0466707_352470 | 3300042601 | Bacteria | 1068 |
| 98 | Ga0466698_202945 | 3300042610 | Bacteria | 1008 |
| 99 | JGI24698J34947_10018261 | 3300002449 | Bacteria | 3792 |
| 100 | Ga0072941_1080775 | 3300005201 | Bacteria | 2510 |
| 101 | Ga0466729_001379 | 3300042621 | Bacteria | 1446 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07009 | NusG_II | NusG domain II | 42 | 137 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.