Protein Family IF08380
Metagenome
Isolate
147
Members
71
Samples
122
Scaffolds
212.33
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_031710|Ga0466728_031710_521_1231
- Length
- 236 aa
- Sequence
- MFLKNWKPSSAGLTVLAGSRIKVVMKKIFAKGTTILFQGDSVTDCHRARDDENSLGEGYPAKIAGIWELLFPQSGVRFLNRGISGNRTGDLLGRYEDDFAALKPDLISILIGINDTWRRYDRNNPTSTEKFEQNYRSLLEKLKRDLPAAAIVIMEPFLLDSDPAKRLWREDLDPKIQAVRNLAREFAGFFIPLDGILASYAAGGIKDADMSADGVHPSPQGHGIIAGEWLKALGVF
Sample Types
Isolate
17.0%
Metagenome
83.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.1%
Kalotermitidae
21.5%
Termitidae
15.4%
Blattidae
13.8%
Culicidae
6.2%
Rhinotermitidae
4.6%
Termopsidae
4.6%
Scarabaeidae
3.1%
Armadillidiidae
3.1%
Tenebrionidae
3.1%
Passalidae
1.5%
Taxonomy
Archaea
0
Bacteria
144
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 2 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 3 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 4 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 5 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 11 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 12 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 13 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 23 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 26 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 27 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 28 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 29 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 30 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 31 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 32 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 33 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 41 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 42 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 46 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 47 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 52 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 53 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 56 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 60 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 61 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 62 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 66 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 67 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 68 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 69 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 70 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160435_1005136 | 3300012857 | Bacteria | 2991 |
| 2 | Ga0123353_10172228 | 3300010167 | Bacteria | 3435 |
| 3 | Ga0160442_100013 | 3300012806 | Bacteria | 424413 |
| 4 | Ga0466707_178498 | 3300042601 | Bacteria | 2481 |
| 5 | Ga0466722_096622 | 3300042609 | Bacteria | 1747 |
| 6 | Ga0466723_140611 | 3300042618 | Bacteria | 44885 |
| 7 | Ga0466726_469330 | 3300042619 | Bacteria | 1645 |
| 8 | Ga0466735_202781 | 3300042624 | Bacteria | 4699 |
| 9 | Ga0466703_139021 | 3300042636 | Bacteria | 6161 |
| 10 | Ga0466704_299542 | 3300042643 | Bacteria | 2071 |
| 11 | Ga0466708_300694 | 3300042652 | Bacteria | 12759 |
| 12 | Ga0264413_148462 | 3300024493 | Bacteria | 1763 |
| 13 | Ga0466692_079540 | 3300042591 | Bacteria | 1193 |
| 14 | Ga0466694_324409 | 3300042594 | Bacteria | 9725 |
| 15 | Ga0466716_532593 | 3300042605 | Bacteria | 3798 |
| 16 | Ga0466726_465022 | 3300042619 | Bacteria | 2840 |
| 17 | Ga0466702_439305 | 3300042635 | Bacteria | 4057 |
| 18 | Ga0466704_273205 | 3300042643 | Bacteria | 9213 |
| 19 | Ga0466704_372785 | 3300042643 | Bacteria | 1504 |
| 20 | Ga0466708_251327 | 3300042652 | Bacteria | 2720 |
| 21 | Ga0466727_081158 | 3300042655 | Bacteria | 1643 |
| 22 | Ga0466727_231389 | 3300042655 | Bacteria | 3199 |
| 23 | Ga0466705_096802 | 3300042612 | Bacteria | 3971 |
| 24 | Ga0160452_100824 | 3300012834 | Bacteria | 13211 |
| 25 | Ga0160445_102035 | 3300012847 | Bacteria | 4980 |
| 26 | Ga0123356_10176832 | 3300010049 | Bacteria | 2151 |
| 27 | Ga0123353_10786674 | 3300010167 | Bacteria | 1317 |
| 28 | Ga0068305_10304929 | 3300005083 | Bacteria | 1028 |
| 29 | Ga0466711_409536 | 3300042615 | Bacteria | 5304 |
| 30 | Ga0466715_228639 | 3300042616 | Bacteria | 46039 |
| 31 | Ga0466726_178376 | 3300042619 | Bacteria | 1305 |
| 32 | Ga0466702_430672 | 3300042635 | Bacteria | 1140 |
| 33 | Ga0466709_002938 | 3300042648 | Bacteria | 7524 |
| 34 | Ga0562378_0409 | 3300056814 | Bacteria | 78692 |
| 35 | Ga0466694_008443 | 3300042594 | Bacteria | 8709 |
| 36 | Ga0466696_067759 | 3300042596 | Bacteria | 4129 |
| 37 | Ga0123353_10159843 | 3300010167 | Bacteria | 3588 |
| 38 | Ga0160471_100012 | 3300012812 | Bacteria | 433895 |
| 39 | Ga0466719_245527 | 3300042606 | Unclassified | 2024 |
| 40 | Ga0466722_209348 | 3300042609 | Bacteria | 5157 |
| 41 | Ga0466715_302518 | 3300042616 | Bacteria | 11190 |
| 42 | Ga0466723_018371 | 3300042618 | Bacteria | 14236 |
| 43 | Ga0466723_250435 | 3300042618 | Bacteria | 3346 |
| 44 | Ga0466726_189794 | 3300042619 | Bacteria | 3887 |
| 45 | Ga0466726_408560 | 3300042619 | Bacteria | 11299 |
| 46 | Ga0466728_053228 | 3300042620 | Bacteria | 1464 |
| 47 | Ga0466735_084788 | 3300042624 | Bacteria | 27734 |
| 48 | Ga0466703_288405 | 3300042636 | Bacteria | 3359 |
| 49 | Ga0466704_117530 | 3300042643 | Bacteria | 2471 |
| 50 | Ga0466704_373046 | 3300042643 | Bacteria | 1893 |
| 51 | Ga0466708_214029 | 3300042652 | Bacteria | 1368 |
| 52 | Ga0466727_185131 | 3300042655 | Bacteria | 6356 |
| 53 | Ga0466733_061981 | 3300042659 | Bacteria | 9950 |
| 54 | Ga0160457_1000799 | 3300012858 | Bacteria | 11135 |
| 55 | Ga0415639_029931 | 3300038395 | Bacteria | 1680 |
| 56 | Ga0466690_094969 | 3300042590 | Bacteria | 9985 |
| 57 | Ga0466691_035641 | 3300042593 | Bacteria | 4112 |
| 58 | Ga0466691_041411 | 3300042593 | Bacteria | 9476 |
| 59 | Ga0466696_081521 | 3300042596 | Bacteria | 15203 |
| 60 | Ga0123353_10010947 | 3300010167 | Bacteria | 12720 |
| 61 | Ga0160454_100474 | 3300012798 | Bacteria | 15193 |
| 62 | Ga0160466_100735 | 3300012809 | Bacteria | 13289 |
| 63 | Ga0123357_10000061 | 3300009784 | Bacteria | 85874 |
| 64 | Ga0466713_019780 | 3300042602 | Bacteria | 1982 |
| 65 | Ga0466714_007640 | 3300042603 | Bacteria | 3704 |
| 66 | Ga0466719_134639 | 3300042606 | Bacteria | 8094 |
| 67 | Ga0466715_233938 | 3300042616 | Bacteria | 9949 |
| 68 | Ga0466715_321032 | 3300042616 | Bacteria | 166710 |
| 69 | Ga0466702_093780 | 3300042635 | Bacteria | 1509 |
| 70 | Ga0466703_097273 | 3300042636 | Bacteria | 4691 |
| 71 | Ga0466703_163052 | 3300042636 | Unclassified | 2527 |
| 72 | Ga0466704_136231 | 3300042643 | Unclassified | 15716 |
| 73 | Ga0466708_237493 | 3300042652 | Bacteria | 5960 |
| 74 | Ga0466727_186077 | 3300042655 | Bacteria | 3848 |
| 75 | Ga0466727_208732 | 3300042655 | Bacteria | 1133 |
| 76 | Ga0466705_214300 | 3300042612 | Bacteria | 1475 |
| 77 | Ga0466705_384428 | 3300042612 | Bacteria | 3178 |
| 78 | Ga0160436_1000057 | 3300012861 | Bacteria | 60713 |
| 79 | Ga0466692_075566 | 3300042591 | Bacteria | 3542 |
| 80 | Ga0466696_086011 | 3300042596 | Bacteria | 6939 |
| 81 | Ga0466696_380960 | 3300042596 | Bacteria | 4064 |
| 82 | Ga0160442_100216 | 3300012806 | Bacteria | 45415 |
| 83 | Ga0072941_1091563 | 3300005201 | Bacteria | 4451 |
| 84 | Ga0466707_355560 | 3300042601 | Bacteria | 1955 |
| 85 | Ga0466719_196945 | 3300042606 | Bacteria | 2102 |
| 86 | Ga0466711_309120 | 3300042615 | Bacteria | 3178 |
| 87 | Ga0466715_544118 | 3300042616 | Bacteria | 2426 |
| 88 | Ga0466702_001931 | 3300042635 | Bacteria | 1486 |
| 89 | Ga0466702_196301 | 3300042635 | Bacteria | 4785 |
| 90 | Ga0466702_372816 | 3300042635 | Bacteria | 2042 |
| 91 | Ga0466704_005238 | 3300042643 | Bacteria | 12409 |
| 92 | Ga0466727_033046 | 3300042655 | Bacteria | 1403 |
| 93 | Ga0466727_034668 | 3300042655 | Bacteria | 1146 |
| 94 | Ga0466727_227385 | 3300042655 | Bacteria | 3828 |
| 95 | Ga0466727_267029 | 3300042655 | Bacteria | 1121 |
| 96 | Ga0466733_051888 | 3300042659 | Bacteria | 1696 |
| 97 | IMNBL1DRAFT_c0021081 | 3300000062 | Bacteria | 2618 |
| 98 | Ga0466707_405973 | 3300042601 | Bacteria | 1807 |
| 99 | Ga0466716_084379 | 3300042605 | Bacteria | 6315 |
| 100 | Ga0466719_562288 | 3300042606 | Bacteria | 8104 |
| 101 | Ga0466705_414717 | 3300042612 | Bacteria | 9688 |
| 102 | Ga0466711_162747 | 3300042615 | Bacteria | 5199 |
| 103 | Ga0466728_031710 | 3300042620 | Bacteria | 1898 |
| 104 | Ga0466735_145296 | 3300042624 | Bacteria | 1680 |
| 105 | Ga0466703_093610 | 3300042636 | Bacteria | 45768 |
| 106 | Ga0466703_246977 | 3300042636 | Bacteria | 6707 |
| 107 | Ga0466703_292632 | 3300042636 | Bacteria | 1171 |
| 108 | Ga0562376_1444 | 3300056857 | Bacteria | 33390 |
| 109 | Ga0160446_105327 | 3300012835 | Bacteria | 1842 |
| 110 | Ga0466690_027322 | 3300042590 | Bacteria | 7052 |
| 111 | Ga0466693_429639 | 3300042592 | Bacteria | 61681 |
| 112 | Ga0466694_185997 | 3300042594 | Bacteria | 1405 |
| 113 | Ga0466707_019816 | 3300042601 | Bacteria | 11178 |
| 114 | Ga0466714_077896 | 3300042603 | Bacteria | 1442 |
| 115 | Ga0466711_343442 | 3300042615 | Bacteria | 1488 |
| 116 | Ga0466723_080919 | 3300042618 | Bacteria | 4815 |
| 117 | Ga0466729_114557 | 3300042621 | Bacteria | 5857 |
| 118 | Ga0466735_143656 | 3300042624 | Bacteria | 1330 |
| 119 | Ga0466703_423953 | 3300042636 | Bacteria | 1735 |
| 120 | Ga0466704_066525 | 3300042643 | Bacteria | 3409 |
| 121 | Ga0466709_230563 | 3300042648 | Bacteria | 9888 |
| 122 | Ga0466709_303144 | 3300042648 | Bacteria | 8359 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00657 | GO:0016788 | hydrolase activity, acting on ester bonds | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.