Protein Family IF08376
Metagenome
Isolate
134
Members
36
Samples
132
Scaffolds
284.65
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_025076|Ga0466728_025076_13915_14886
- Length
- 323 aa
- Sequence
- MKKIFQRLLIFFIAVPLVLALVVFFPQRNHLALNIVILVFIGLGSAEFSVILGVCSASRAKSPKTAGEELIYHPGRIRPNTGTTTWVIPVKRQVEAAILGILAPLTMTIVSGFSPIPGNLDISSLASSAAFILGGIWVLLSRVFSPEAELQDYTRHTASGFSVMVYPGLFLIWLIRMTTLTSSSLVILVFLLMVFGSDSVAWAAGMLFGKGNRGIVAASPNKSVAGFIGGIGASILVGAGAEFFIGDALVSRFFPSPFAGILLGFLSGCASSLGDLAESALKRSSGIKDSGTLIPGRGGVLDSIDSIALAAPVFYLSYRILFQ
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Termitidae
31.4%
Unclassified
14.3%
Termopsidae
8.6%
Rhinotermitidae
5.7%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_029399 | 3300042590 | Bacteria | 4867 |
| 2 | Ga0466692_105884 | 3300042591 | Bacteria | 8409 |
| 3 | Ga0466692_140971 | 3300042591 | Bacteria | 4193 |
| 4 | Ga0466699_015014 | 3300042597 | Bacteria | 13008 |
| 5 | Ga0466705_495994 | 3300042612 | Bacteria | 1958 |
| 6 | Ga0466705_496353 | 3300042612 | Unclassified | 4848 |
| 7 | Ga0466711_342591 | 3300042615 | Bacteria | 80397 |
| 8 | Ga0466715_120929 | 3300042616 | Bacteria | 51611 |
| 9 | Ga0466723_185275 | 3300042618 | Bacteria | 4342 |
| 10 | Ga0466723_366388 | 3300042618 | Bacteria | 5604 |
| 11 | Ga0466726_007778 | 3300042619 | Bacteria | 7770 |
| 12 | Ga0466726_333336 | 3300042619 | Bacteria | 1028 |
| 13 | Ga0466726_357659 | 3300042619 | Bacteria | 1132 |
| 14 | Ga0466728_171577 | 3300042620 | Bacteria | 15599 |
| 15 | Ga0466700_189718 | 3300042600 | Bacteria | 2783 |
| 16 | Ga0466719_377642 | 3300042606 | Bacteria | 21657 |
| 17 | Ga0466698_368096 | 3300042610 | Bacteria | 2049 |
| 18 | Ga0466704_277856 | 3300042643 | Bacteria | 2881 |
| 19 | Ga0466704_524974 | 3300042643 | Bacteria | 27446 |
| 20 | Ga0466727_293849 | 3300042655 | Bacteria | 1586 |
| 21 | Ga0264413_148793 | 3300024493 | Bacteria | 1044 |
| 22 | Ga0466692_039371 | 3300042591 | Bacteria | 2695 |
| 23 | Ga0466692_108071 | 3300042591 | Bacteria | 9633 |
| 24 | Ga0466726_434233 | 3300042619 | Bacteria | 1359 |
| 25 | Ga0466707_046100 | 3300042601 | Bacteria | 2707 |
| 26 | Ga0466713_037146 | 3300042602 | Bacteria | 3072 |
| 27 | Ga0466716_103981 | 3300042605 | Bacteria | 1742 |
| 28 | Ga0466716_183619 | 3300042605 | Bacteria | 1442 |
| 29 | Ga0068305_10032775 | 3300005083 | Unclassified | 4672 |
| 30 | Ga0466704_164699 | 3300042643 | Unclassified | 11757 |
| 31 | Ga0466709_262981 | 3300042648 | Bacteria | 44599 |
| 32 | Ga0466708_264944 | 3300042652 | Bacteria | 11542 |
| 33 | Ga0466691_121500 | 3300042593 | Bacteria | 8749 |
| 34 | Ga0466723_151679 | 3300042618 | Bacteria | 7363 |
| 35 | Ga0466723_230198 | 3300042618 | Bacteria | 8043 |
| 36 | Ga0466726_086682 | 3300042619 | Bacteria | 1211 |
| 37 | Ga0466719_035069 | 3300042606 | Bacteria | 14650 |
| 38 | Ga0466722_076969 | 3300042609 | Bacteria | 6265 |
| 39 | Ga0466722_098352 | 3300042609 | Bacteria | 1186 |
| 40 | Ga0466704_109916 | 3300042643 | Bacteria | 23762 |
| 41 | Ga0466704_163614 | 3300042643 | Bacteria | 3323 |
| 42 | Ga0466704_184956 | 3300042643 | Bacteria | 8589 |
| 43 | Ga0466708_043659 | 3300042652 | Bacteria | 5056 |
| 44 | Ga0466708_146826 | 3300042652 | Bacteria | 14862 |
| 45 | Ga0466692_190677 | 3300042591 | Bacteria | 12373 |
| 46 | Ga0466691_125072 | 3300042593 | Bacteria | 14179 |
| 47 | Ga0466691_209330 | 3300042593 | Bacteria | 7873 |
| 48 | Ga0466696_155925 | 3300042596 | Bacteria | 1469 |
| 49 | Ga0466723_291555 | 3300042618 | Bacteria | 20915 |
| 50 | Ga0466723_356794 | 3300042618 | Bacteria | 7448 |
| 51 | Ga0466726_078444 | 3300042619 | Bacteria | 7425 |
| 52 | Ga0466726_301510 | 3300042619 | Bacteria | 1462 |
| 53 | Ga0466722_035457 | 3300042609 | Bacteria | 25393 |
| 54 | Ga0466722_143123 | 3300042609 | Bacteria | 18058 |
| 55 | Ga0466703_181939 | 3300042636 | Bacteria | 6903 |
| 56 | Ga0466703_187864 | 3300042636 | Bacteria | 71803 |
| 57 | Ga0466709_108611 | 3300042648 | Bacteria | 13737 |
| 58 | Ga0466708_104818 | 3300042652 | Bacteria | 10294 |
| 59 | Ga0466732_018437 | 3300042656 | Bacteria | 1026 |
| 60 | Ga0123354_10070452 | 3300010882 | Bacteria | 5056 |
| 61 | Ga0466690_313579 | 3300042590 | Bacteria | 41778 |
| 62 | Ga0466692_010047 | 3300042591 | Bacteria | 7479 |
| 63 | Ga0466692_048878 | 3300042591 | Bacteria | 1707 |
| 64 | Ga0466715_274152 | 3300042616 | Bacteria | 5618 |
| 65 | Ga0466715_500329 | 3300042616 | Bacteria | 2963 |
| 66 | Ga0466726_347405 | 3300042619 | Bacteria | 3676 |
| 67 | Ga0466726_354833 | 3300042619 | Bacteria | 2886 |
| 68 | Ga0466707_093645 | 3300042601 | Bacteria | 1061 |
| 69 | Ga0466716_348760 | 3300042605 | Bacteria | 2161 |
| 70 | Ga0466719_390938 | 3300042606 | Bacteria | 1284 |
| 71 | Ga0466722_016207 | 3300042609 | Bacteria | 3425 |
| 72 | Ga0466722_033280 | 3300042609 | Bacteria | 4644 |
| 73 | Ga0466704_163676 | 3300042643 | Bacteria | 22512 |
| 74 | Ga0466705_333083 | 3300042612 | Unclassified | 3474 |
| 75 | Ga0466705_348832 | 3300042612 | Bacteria | 18922 |
| 76 | Ga0123353_10915886 | 3300010167 | Bacteria | 1191 |
| 77 | Ga0466690_119992 | 3300042590 | Bacteria | 4995 |
| 78 | Ga0466690_159409 | 3300042590 | Bacteria | 7401 |
| 79 | Ga0466694_349619 | 3300042594 | Bacteria | 1956 |
| 80 | Ga0466712_095009 | 3300042614 | Bacteria | 4288 |
| 81 | Ga0466715_303747 | 3300042616 | Bacteria | 3446 |
| 82 | Ga0466707_162389 | 3300042601 | Bacteria | 3373 |
| 83 | Ga0466716_161805 | 3300042605 | Bacteria | 10935 |
| 84 | Ga0466719_558771 | 3300042606 | Bacteria | 6132 |
| 85 | Ga0466722_144391 | 3300042609 | Bacteria | 6608 |
| 86 | Ga0466722_256195 | 3300042609 | Bacteria | 1658 |
| 87 | JGI24698J34947_10016482 | 3300002449 | Bacteria | 4011 |
| 88 | JGI24695J34938_10033906 | 3300002450 | Bacteria | 2345 |
| 89 | Ga0466704_184292 | 3300042643 | Bacteria | 1432 |
| 90 | Ga0466704_424682 | 3300042643 | Bacteria | 23839 |
| 91 | Ga0466708_229137 | 3300042652 | Bacteria | 6792 |
| 92 | Ga0466727_163388 | 3300042655 | Bacteria | 1778 |
| 93 | Ga0466727_281507 | 3300042655 | Bacteria | 6003 |
| 94 | Ga0466705_078278 | 3300042612 | Bacteria | 19606 |
| 95 | Ga0466691_006943 | 3300042593 | Bacteria | 9054 |
| 96 | Ga0466694_283098 | 3300042594 | Bacteria | 3876 |
| 97 | Ga0466696_281829 | 3300042596 | Bacteria | 3216 |
| 98 | Ga0466723_278968 | 3300042618 | Bacteria | 4045 |
| 99 | Ga0466728_025076 | 3300042620 | Bacteria | 15424 |
| 100 | Ga0466728_192052 | 3300042620 | Bacteria | 1754 |
| 101 | Ga0466728_249690 | 3300042620 | Bacteria | 21893 |
| 102 | Ga0466707_127328 | 3300042601 | Bacteria | 1519 |
| 103 | Ga0466707_252218 | 3300042601 | Bacteria | 1130 |
| 104 | Ga0466719_187019 | 3300042606 | Bacteria | 6283 |
| 105 | JGI24695J34938_10011588 | 3300002450 | Bacteria | 4741 |
| 106 | Ga0074263_103736 | 3300005485 | Unclassified | 2644 |
| 107 | Ga0466735_054625 | 3300042624 | Bacteria | 1780 |
| 108 | Ga0466703_189115 | 3300042636 | Bacteria | 11684 |
| 109 | Ga0466709_066227 | 3300042648 | Bacteria | 30258 |
| 110 | Ga0466709_261950 | 3300042648 | Bacteria | 34221 |
| 111 | Ga0466708_040038 | 3300042652 | Bacteria | 6468 |
| 112 | Ga0466708_085647 | 3300042652 | Bacteria | 19327 |
| 113 | Ga0466727_293169 | 3300042655 | Bacteria | 1907 |
| 114 | Ga0466705_226352 | 3300042612 | Bacteria | 22687 |
| 115 | Ga0466690_301774 | 3300042590 | Bacteria | 4698 |
| 116 | Ga0466692_022495 | 3300042591 | Bacteria | 1950 |
| 117 | Ga0466691_172932 | 3300042593 | Bacteria | 2640 |
| 118 | Ga0466696_085180 | 3300042596 | Bacteria | 7209 |
| 119 | Ga0466696_216805 | 3300042596 | Bacteria | 16474 |
| 120 | Ga0466705_493643 | 3300042612 | Bacteria | 6740 |
| 121 | Ga0466711_434846 | 3300042615 | Bacteria | 2463 |
| 122 | Ga0466726_237528 | 3300042619 | Bacteria | 1684 |
| 123 | Ga0466728_269899 | 3300042620 | Bacteria | 5867 |
| 124 | Ga0466728_269974 | 3300042620 | Bacteria | 5381 |
| 125 | Ga0466707_277844 | 3300042601 | Bacteria | 2118 |
| 126 | Ga0466716_022210 | 3300042605 | Bacteria | 20428 |
| 127 | Ga0466722_029238 | 3300042609 | Bacteria | 7846 |
| 128 | Ga0466722_047883 | 3300042609 | Bacteria | 1933 |
| 129 | Ga0466722_057493 | 3300042609 | Bacteria | 12192 |
| 130 | Ga0466735_067542 | 3300042624 | Bacteria | 16235 |
| 131 | Ga0466703_176800 | 3300042636 | Bacteria | 3154 |
| 132 | Ga0466704_063886 | 3300042643 | Bacteria | 26674 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01148 | CTP_transf_1 | Cytidylyltransferase family | 126 | 320 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.