Protein Family IF08375

Metagenome Isolate
108 Members
37 Samples
106 Scaffolds
531.01 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_023682|Ga0466728_023682_1625_3334
Length
569 aa
Sequence
MKELYKSLQKGEILRGSVAGRLFKPEERLNYADSFIKVDQKPIDLDFWQQDHIRDTHRYCIILKGRRTGFSFDVALKGIIKSQDKARYKYTRQFVSYNEDDAKEKINYAKEFYHSTPKLHRKELVSETKTTMEFYDRGGKTTSRLISIACRPPRGRGGDIVFDEMAIYPQNRVQTIYTAGLPVIARGGCVEIGSTPLGKIGLFYDIYTNPKENGKEKYPEYQRYMVPWWYVKDLCKDVKEAVKLAPDMETEDRVDIFGTDTIKTLFNSMLLEDFQQEFECIFVDSAMSYITLDLIYANTPGMREEDRADSLQEGEGESLERDNDGIEVKIFRDADSLVLGYKPEKHGRLFLGYDIARFRDAAVIFVIGQLPNGKKISVAEIEMRGQTFDYQIDQFKKILMNPPIVRACIDRGGMGEPICEWLQKEFGDSVVEGVKFDAVSKEEMATSVRKGLEKREFLLQNDSKFHRQIHSIKRFPISGGGFRYDSTKDEDGHADSFWAWALADRAVIKGEDSGNFYTRRASKKIQDAVRSGQETKPSGVNDNGPPLTKGRGRSLSSVLGGVDRANRKK

📊 Sample Types

Isolate 1.9%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.0%
Termitidae 31.4%
Rhinotermitidae 11.4%
Unclassified 11.4%
Termopsidae 5.7%

🌳 Taxonomy

Archaea 2
Bacteria 98
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_079779 3300042624 Bacteria 6751
2 Ga0466703_340141 3300042636 Bacteria 33698
3 Ga0466704_200776 3300042643 Bacteria 17601
4 Ga0466712_248075 3300042614 Bacteria 75445
5 Ga0466712_269304 3300042614 Bacteria 27593
6 Ga0466718_036153 3300042617 Bacteria 2155
7 Ga0466726_011525 3300042619 Bacteria 5698
8 Ga0466726_058113 3300042619 Bacteria 2523
9 Ga0466726_261795 3300042619 Bacteria 1859
10 Ga0466692_049276 3300042591 Bacteria 3769
11 Ga0466691_174048 3300042593 Bacteria 7021
12 Ga0466694_135259 3300042594 Bacteria 9571
13 Ga0466694_223323 3300042594 Bacteria 19993
14 Ga0466722_107340 3300042609 Bacteria 2684
15 Ga0072941_1035952 3300005201 Bacteria 9486
16 Ga0466705_164208 3300042612 Bacteria 4756
17 Ga0466708_421319 3300042652 Unclassified 3701
18 Ga0466708_435645 3300042652 Bacteria 5078
19 Ga0466711_233593 3300042615 Bacteria 4931
20 Ga0466711_267609 3300042615 Bacteria 6674
21 Ga0466715_376449 3300042616 Bacteria 3096
22 Ga0456237_0006765 3300041968 Bacteria 1788
23 Ga0466690_011088 3300042590 Bacteria 4549
24 Ga0466690_055830 3300042590 Bacteria 5623
25 Ga0466691_026315 3300042593 Bacteria 28125
26 Ga0466699_380189 3300042597 Unclassified 6358
27 Ga0466716_269973 3300042605 Bacteria 10748
28 Ga0466716_475815 3300042605 Unclassified 11439
29 Ga0466722_088763 3300042609 Bacteria 8376
30 JGI24698J34947_10006033 3300002449 Unclassified 6654
31 Ga0466705_310126 3300042612 Bacteria 5438
32 Ga0466704_051484 3300042643 Unclassified 20188
33 Ga0466709_046911 3300042648 Bacteria 2887
34 Ga0466709_414869 3300042648 Bacteria 8140
35 Ga0466711_114747 3300042615 Bacteria 3658
36 Ga0466711_231196 3300042615 Bacteria 5160
37 Ga0466711_246763 3300042615 Bacteria 6996
38 Ga0466715_090089 3300042616 Archaea 8799
39 Ga0466690_038212 3300042590 Unclassified 5815
40 Ga0466690_089374 3300042590 Bacteria 14241
41 Ga0466719_059773 3300042606 Bacteria 7505
42 Ga0466732_273680 3300042656 Bacteria 4437
43 Ga0466702_174015 3300042635 Bacteria 2094
44 Ga0466704_329884 3300042643 Bacteria 4435
45 Ga0466709_103043 3300042648 Bacteria 5874
46 Ga0466715_124219 3300042616 Unclassified 14335
47 Ga0466718_028024 3300042617 Bacteria 5412
48 Ga0466728_023682 3300042620 Bacteria 5122
49 Ga0466694_243983 3300042594 Bacteria 3665
50 Ga0466713_127324 3300042602 Archaea 3330
51 Ga0466716_231591 3300042605 Bacteria 15891
52 Ga0466735_140627 3300042624 Bacteria 6060
53 Ga0466703_029221 3300042636 Bacteria 10986
54 Ga0466704_143937 3300042643 Bacteria 3685
55 Ga0466704_257051 3300042643 Bacteria 5638
56 Ga0466718_020228 3300042617 Bacteria 8554
57 Ga0264413_119807 3300024493 Bacteria 30485
58 Ga0415639_195632 3300038395 Bacteria 2348
59 Ga0466692_052268 3300042591 Bacteria 8843
60 Ga0466699_029809 3300042597 Bacteria 102248
61 Ga0466716_121652 3300042605 Bacteria 4101
62 Ga0466716_280230 3300042605 Bacteria 2325
63 JGI24695J34938_10026993 3300002450 Bacteria 2720
64 Ga0068305_10056669 3300005083 Bacteria 6841
65 Ga0072940_1008144 3300005200 Bacteria 4066
66 Ga0072940_1156242 3300005200 Bacteria 3306
67 Ga0466709_018818 3300042648 Bacteria 5553
68 Ga0466709_310274 3300042648 Bacteria 3143
69 Ga0466708_373004 3300042652 Bacteria 2752
70 Ga0466715_582012 3300042616 Bacteria 3626
71 Ga0466723_156718 3300042618 Bacteria 5769
72 Ga0415639_066235 3300038395 Bacteria 22885
73 Ga0466690_215310 3300042590 Bacteria 1659
74 Ga0466691_070590 3300042593 Bacteria 8794
75 Ga0466691_225919 3300042593 Bacteria 4055
76 Ga0466716_139298 3300042605 Bacteria 2710
77 Ga0466698_090585 3300042610 Bacteria 3466
78 JGI24695J34938_10043398 3300002450 Bacteria 2006
79 Ga0466703_004876 3300042636 Bacteria 3814
80 Ga0466704_047615 3300042643 Bacteria 17279
81 Ga0466708_270615 3300042652 Bacteria 4300
82 Ga0466708_307743 3300042652 Bacteria 2610
83 Ga0466715_423352 3300042616 Bacteria 6067
84 Ga0466728_208123 3300042620 Bacteria 3208
85 Ga0466728_241950 3300042620 Bacteria 5158
86 Ga0466696_219663 3300042596 Bacteria 3912
87 JGI24698J34947_10028796 3300002449 Bacteria 2939
88 Ga0072940_1034898 3300005200 Bacteria 8245
89 Ga0072940_1445906 3300005200 Bacteria 2908
90 Ga0466705_059172 3300042612 Bacteria 12059
91 Ga0466705_096480 3300042612 Bacteria 64004
92 Ga0466705_192785 3300042612 Bacteria 21551
93 Ga0466705_358223 3300042612 Bacteria 3550
94 Ga0466729_215700 3300042621 Bacteria 9100
95 Ga0466703_316055 3300042636 Bacteria 4392
96 Ga0466709_341624 3300042648 Unclassified 3151
97 Ga0466708_344902 3300042652 Bacteria 6809
98 Ga0466705_491804 3300042612 Bacteria 20953
99 Ga0466711_235762 3300042615 Bacteria 6598
100 Ga0466718_043909 3300042617 Bacteria 59265
101 Ga0466726_047774 3300042619 Bacteria 2047
102 Ga0466728_065807 3300042620 Bacteria 5505
103 Ga0466694_067226 3300042594 Bacteria 5818
104 Ga0466694_277288 3300042594 Bacteria 3412
105 Ga0072940_1005328 3300005200 Bacteria 51697
106 Ga0072940_1078591 3300005200 Bacteria 10782

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1445906 Ga0072940_14459062 458
2 3300042643 Ga0466704_329884 Ga0466704_329884_31_1470 479
3 3300042617 Ga0466718_036153 Ga0466718_036153_22_1464 480
4 3300041968 Ga0456237_0006765 Ga0456237_0006765_53_1543 484
5 3300002450 JGI24695J34938_10043398 JGI24695J34938_100433982 486
6 3300042652 Ga0466708_270615 Ga0466708_270615_85_1626 487
7 3300042605 Ga0466716_139298 Ga0466716_139298_1042_2541 491
8 3300042612 Ga0466705_164208 Ga0466705_164208_1654_3216 496
9 3300042605 Ga0466716_280230 Ga0466716_280230_16_1632 501
10 3300024493 Ga0264413_119807 Ga0264413_11980747 508
11 3300042605 Ga0466716_475815 Ga0466716_475815_6171_7775 511
12 3300042612 Ga0466705_358223 Ga0466705_358223_321_1883 512
13 3300042619 Ga0466726_261795 Ga0466726_261795_41_1633 512
14 3300042636 Ga0466703_340141 Ga0466703_340141_13032_14663 512
15 3300042591 Ga0466692_049276 Ga0466692_049276_655_2268 515
16 3300005200 Ga0072940_1034898 Ga0072940_10348986 516
17 3300042648 Ga0466709_046911 Ga0466709_046911_1228_2844 516
18 3300042648 Ga0466709_414869 Ga0466709_414869_4967_6562 516
19 3300042590 Ga0466690_215310 Ga0466690_215310_18_1637 517
20 3300005200 Ga0072940_1008144 Ga0072940_10081442 518
21 3300042591 Ga0466692_052268 Ga0466692_052268_922_2550 518
22 3300038395 Ga0415639_195632 Ga0415639_195632_551_2140 519
23 3300042643 Ga0466704_143937 Ga0466704_143937_1547_3163 519
24 3300042593 Ga0466691_026315 Ga0466691_026315_2788_4356 522
25 3300042609 Ga0466722_107340 Ga0466722_107340_994_2613 522
26 3300042635 Ga0466702_174015 Ga0466702_174015_81_1691 524
27 3300042590 Ga0466690_055830 Ga0466690_055830_1261_2883 526
28 3300042619 Ga0466726_047774 Ga0466726_047774_303_1883 526
29 3300042605 Ga0466716_269973 Ga0466716_269973_3765_5348 527
30 3300042620 Ga0466728_208123 Ga0466728_208123_469_2091 527
31 3300042636 Ga0466703_316055 Ga0466703_316055_1473_3083 527
32 3300002449 JGI24698J34947_10006033 JGI24698J34947_100060332 528
33 3300042594 Ga0466694_135259 Ga0466694_135259_1934_3541 529
34 3300042609 Ga0466722_088763 Ga0466722_088763_2129_3718 529
35 iso_pr_bacteria 2781125683 2781410077 529
36 3300042590 Ga0466690_038212 Ga0466690_038212_1661_3253 530
37 3300042593 Ga0466691_070590 Ga0466691_070590_5819_7411 530
38 3300042636 Ga0466703_029221 Ga0466703_029221_2799_4430 530
39 3300042593 Ga0466691_225919 Ga0466691_225919_2171_3766 531
40 3300042610 Ga0466698_090585 Ga0466698_090585_1707_3302 531
41 3300042617 Ga0466718_043909 Ga0466718_043909_34078_35673 531
42 3300042648 Ga0466709_310274 Ga0466709_310274_281_1891 531
43 3300042652 Ga0466708_421319 Ga0466708_421319_174_1784 531
44 3300042615 Ga0466711_233593 Ga0466711_233593_1508_3106 532
45 3300042615 Ga0466711_235762 Ga0466711_235762_4782_6380 532
46 3300042648 Ga0466709_103043 Ga0466709_103043_1595_3193 532
47 3300038395 Ga0415639_066235 Ga0415639_066235_3507_5108 533
48 3300042602 Ga0466713_127324 Ga0466713_127324_1126_2727 533
49 3300042614 Ga0466712_269304 Ga0466712_269304_20016_21617 533
50 3300042615 Ga0466711_231196 Ga0466711_231196_1414_3015 533
51 3300042624 Ga0466735_140627 Ga0466735_140627_2910_4574 533
52 3300042636 Ga0466703_004876 Ga0466703_004876_1466_3067 533
53 3300042643 Ga0466704_200776 Ga0466704_200776_11344_12945 533
54 3300042605 Ga0466716_231591 Ga0466716_231591_3644_5248 534
55 3300042616 Ga0466715_582012 Ga0466715_582012_1588_3207 534
56 3300042643 Ga0466704_047615 Ga0466704_047615_4739_6343 534
57 3300042643 Ga0466704_257051 Ga0466704_257051_1417_3021 534
58 3300042594 Ga0466694_243983 Ga0466694_243983_383_1990 535
59 3300042612 Ga0466705_310126 Ga0466705_310126_2173_3780 535
60 3300042652 Ga0466708_307743 Ga0466708_307743_985_2592 535
61 3300042620 Ga0466728_241950 Ga0466728_241950_2935_4545 536
62 3300042624 Ga0466735_079779 Ga0466735_079779_4790_6400 536
63 3300005200 Ga0072940_1005328 Ga0072940_100532865 537
64 3300042597 Ga0466699_029809 Ga0466699_029809_41976_43589 537
65 3300042593 Ga0466691_174048 Ga0466691_174048_4439_6094 538
66 3300042612 Ga0466705_096480 Ga0466705_096480_25123_26742 539
67 3300042616 Ga0466715_090089 Ga0466715_090089_3071_4690 539
68 3300042615 Ga0466711_114747 Ga0466711_114747_112_1734 540
69 3300042615 Ga0466711_267609 Ga0466711_267609_2304_3926 540
70 3300002450 JGI24695J34938_10026993 JGI24695J34938_100269931 541
71 3300042605 Ga0466716_121652 Ga0466716_121652_1118_2743 541
72 3300042616 Ga0466715_124219 Ga0466715_124219_9699_11324 541
73 3300042596 Ga0466696_219663 Ga0466696_219663_1505_3160 542
74 3300042648 Ga0466709_341624 Ga0466709_341624_1480_3108 542
75 3300042652 Ga0466708_373004 Ga0466708_373004_1102_2730 542
76 3300005083 Ga0068305_10056669 Ga0068305_100566691 543
77 3300042618 Ga0466723_156718 Ga0466723_156718_1031_2662 543
78 3300042648 Ga0466709_018818 Ga0466709_018818_2865_4496 543
79 3300042606 Ga0466719_059773 Ga0466719_059773_2471_4105 544
80 3300042612 Ga0466705_491804 Ga0466705_491804_15688_17322 544
81 3300042616 Ga0466715_376449 Ga0466715_376449_326_1960 544
82 3300042616 Ga0466715_423352 Ga0466715_423352_1692_3326 544
83 3300042619 Ga0466726_058113 Ga0466726_058113_659_2293 544
84 3300042620 Ga0466728_065807 Ga0466728_065807_3106_4740 544
85 3300042621 Ga0466729_215700 Ga0466729_215700_4963_6597 544
86 3300005201 Ga0072941_1035952 Ga0072941_10359528 545
87 3300042594 Ga0466694_067226 Ga0466694_067226_2989_4626 545
88 3300042597 Ga0466699_380189 Ga0466699_380189_2776_4413 545
89 iso_pr_bacteria 2781125641 2781289789 545
90 3300002449 JGI24698J34947_10028796 JGI24698J34947_100287962 546
91 3300005200 Ga0072940_1078591 Ga0072940_107859116 546
92 3300042590 Ga0466690_011088 Ga0466690_011088_1258_2898 546
93 3300042594 Ga0466694_223323 Ga0466694_223323_5276_6916 546
94 3300042590 Ga0466690_089374 Ga0466690_089374_3095_4738 547
95 3300042614 Ga0466712_248075 Ga0466712_248075_32586_34229 547
96 3300042617 Ga0466718_020228 Ga0466718_020228_3014_4657 547
97 3300042617 Ga0466718_028024 Ga0466718_028024_1049_2692 547
98 3300042652 Ga0466708_344902 Ga0466708_344902_3185_4828 547
99 3300042656 Ga0466732_273680 Ga0466732_273680_651_2294 547
100 3300005200 Ga0072940_1156242 Ga0072940_11562422 548
101 3300042619 Ga0466726_011525 Ga0466726_011525_2577_4223 548
102 3300042612 Ga0466705_192785 Ga0466705_192785_2120_3769 549
103 3300042615 Ga0466711_246763 Ga0466711_246763_3442_5091 549
104 3300042594 Ga0466694_277288 Ga0466694_277288_1025_2677 550
105 3300042612 Ga0466705_059172 Ga0466705_059172_164_1825 553
106 3300042643 Ga0466704_051484 Ga0466704_051484_1717_3378 553
107 3300042652 Ga0466708_435645 Ga0466708_435645_1694_3364 556
108 3300042620 Ga0466728_023682 Ga0466728_023682_1625_3334 569

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17289 Terminase_6C Terminase RNaseH-like domain 352 502 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.