Protein Family IF08335
Metagenome
Isolate
128
Members
35
Samples
127
Scaffolds
270.44
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_388549|Ga0466726_388549_12587_13528
- Length
- 313 aa
- Sequence
- LGTGIALETYRLGKRRISHGDVERGEGKKLGAHKLFGRKGGMDMSEKLLELSNVSCGYGTRTVVQNVSFSLAKGEILCFLGPNGVGKTTLFKAILGFIKTTSGSIRIDGRDIAKWNRKTLAKAVAFVPQVHRPVFPFSVLDMVIMGRTAHVSAFGSPGKQDMKIAVAMLERLNIAELRDKAYTEISGGQQQLVLIARALAQQAKILIMDEPTASLDYGNQIKVLEQVKSLAGEGIAVIMTTHFPDHAFLCATKVALMQADRVFEIGEVAEIVTEQSLGAAYGIRVKITHTLSGDGEWVSGCIPLLGKRELTAS
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
42.4%
Termitidae
24.2%
Termopsidae
12.1%
Unclassified
9.1%
Rhinotermitidae
9.1%
Hodotermitidae
3.0%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_055972 | 3300042612 | Bacteria | 8603 |
| 2 | Ga0264413_134661 | 3300024493 | Bacteria | 5366 |
| 3 | Ga0466690_179262 | 3300042590 | Bacteria | 1291 |
| 4 | Ga0466696_501929 | 3300042596 | Bacteria | 4879 |
| 5 | Ga0123353_10137732 | 3300010167 | Bacteria | 3914 |
| 6 | Ga0466715_042780 | 3300042616 | Bacteria | 1379 |
| 7 | Ga0466723_292206 | 3300042618 | Bacteria | 7577 |
| 8 | Ga0466728_074900 | 3300042620 | Bacteria | 2837 |
| 9 | Ga0466729_193350 | 3300042621 | Bacteria | 8529 |
| 10 | Ga0466707_065401 | 3300042601 | Bacteria | 2514 |
| 11 | Ga0466707_200508 | 3300042601 | Bacteria | 3324 |
| 12 | Ga0466707_276975 | 3300042601 | Bacteria | 4660 |
| 13 | Ga0466722_203851 | 3300042609 | Bacteria | 39655 |
| 14 | Ga0466703_094780 | 3300042636 | Bacteria | 6855 |
| 15 | Ga0466708_191215 | 3300042652 | Bacteria | 1680 |
| 16 | Ga0466708_293519 | 3300042652 | Bacteria | 5259 |
| 17 | Ga0466708_394950 | 3300042652 | Bacteria | 17791 |
| 18 | Ga0068305_10002017 | 3300005083 | Bacteria | 102589 |
| 19 | Ga0072940_1129406 | 3300005200 | Bacteria | 3303 |
| 20 | Ga0466690_027832 | 3300042590 | Bacteria | 3699 |
| 21 | Ga0466691_026112 | 3300042593 | Bacteria | 14231 |
| 22 | Ga0466705_490566 | 3300042612 | Unclassified | 6421 |
| 23 | Ga0466726_481472 | 3300042619 | Bacteria | 1951 |
| 24 | Ga0466728_160307 | 3300042620 | Bacteria | 4482 |
| 25 | Ga0466728_249526 | 3300042620 | Bacteria | 1942 |
| 26 | Ga0466728_375982 | 3300042620 | Bacteria | 5738 |
| 27 | Ga0466707_130060 | 3300042601 | Bacteria | 3265 |
| 28 | Ga0466707_239348 | 3300042601 | Bacteria | 9832 |
| 29 | Ga0466704_366551 | 3300042643 | Bacteria | 3490 |
| 30 | Ga0466704_474129 | 3300042643 | Bacteria | 3511 |
| 31 | Ga0466704_609949 | 3300042643 | Bacteria | 2066 |
| 32 | Ga0466727_136220 | 3300042655 | Bacteria | 4389 |
| 33 | JGI24702J35022_10172027 | 3300002462 | Bacteria | 1226 |
| 34 | Ga0466705_061480 | 3300042612 | Bacteria | 2972 |
| 35 | Ga0466705_338628 | 3300042612 | Bacteria | 3649 |
| 36 | Ga0466690_256965 | 3300042590 | Bacteria | 2678 |
| 37 | Ga0466691_044701 | 3300042593 | Bacteria | 40808 |
| 38 | Ga0466696_380261 | 3300042596 | Bacteria | 20682 |
| 39 | Ga0466696_472198 | 3300042596 | Bacteria | 1886 |
| 40 | Ga0466715_393921 | 3300042616 | Bacteria | 69699 |
| 41 | Ga0466715_603011 | 3300042616 | Bacteria | 118245 |
| 42 | Ga0466726_387272 | 3300042619 | Bacteria | 5920 |
| 43 | Ga0466726_388549 | 3300042619 | Bacteria | 16162 |
| 44 | Ga0466706_089223 | 3300042599 | Bacteria | 94839 |
| 45 | Ga0466707_039586 | 3300042601 | Unclassified | 4175 |
| 46 | Ga0466713_003159 | 3300042602 | Bacteria | 1696 |
| 47 | Ga0466716_076418 | 3300042605 | Bacteria | 2726 |
| 48 | Ga0466719_112824 | 3300042606 | Bacteria | 1838 |
| 49 | Ga0466719_135869 | 3300042606 | Bacteria | 4142 |
| 50 | Ga0466703_238321 | 3300042636 | Bacteria | 6359 |
| 51 | Ga0466704_020973 | 3300042643 | Bacteria | 13479 |
| 52 | Ga0466704_067072 | 3300042643 | Bacteria | 8053 |
| 53 | Ga0466709_361788 | 3300042648 | Bacteria | 53857 |
| 54 | Ga0072940_1040353 | 3300005200 | Bacteria | 1113 |
| 55 | Ga0466732_033349 | 3300042656 | Bacteria | 6939 |
| 56 | Ga0466690_100239 | 3300042590 | Bacteria | 2747 |
| 57 | Ga0466690_412211 | 3300042590 | Bacteria | 1070 |
| 58 | Ga0466692_020118 | 3300042591 | Bacteria | 22362 |
| 59 | Ga0466692_201164 | 3300042591 | Bacteria | 1147 |
| 60 | Ga0466691_033601 | 3300042593 | Bacteria | 5081 |
| 61 | Ga0466705_483838 | 3300042612 | Bacteria | 9764 |
| 62 | Ga0466705_496849 | 3300042612 | Bacteria | 2452 |
| 63 | Ga0466715_319541 | 3300042616 | Bacteria | 7183 |
| 64 | Ga0466718_027481 | 3300042617 | Bacteria | 1278 |
| 65 | Ga0466706_087850 | 3300042599 | Bacteria | 3294 |
| 66 | Ga0466707_005644 | 3300042601 | Bacteria | 9422 |
| 67 | Ga0466707_023442 | 3300042601 | Bacteria | 9090 |
| 68 | Ga0466719_143749 | 3300042606 | Bacteria | 14394 |
| 69 | Ga0466722_012412 | 3300042609 | Bacteria | 2829 |
| 70 | Ga0466704_288402 | 3300042643 | Bacteria | 8567 |
| 71 | Ga0466704_505387 | 3300042643 | Bacteria | 5993 |
| 72 | Ga0466708_456657 | 3300042652 | Bacteria | 1169 |
| 73 | Ga0068302_10010100 | 3300005071 | Bacteria | 13873 |
| 74 | Ga0466705_089706 | 3300042612 | Bacteria | 14343 |
| 75 | Ga0466691_070307 | 3300042593 | Unclassified | 7645 |
| 76 | Ga0466691_114030 | 3300042593 | Bacteria | 10732 |
| 77 | Ga0466696_405468 | 3300042596 | Bacteria | 2734 |
| 78 | Ga0466715_534433 | 3300042616 | Bacteria | 1752 |
| 79 | Ga0466723_040444 | 3300042618 | Bacteria | 40290 |
| 80 | Ga0466726_306713 | 3300042619 | Bacteria | 1314 |
| 81 | Ga0466735_172689 | 3300042624 | Bacteria | 4294 |
| 82 | Ga0466703_113248 | 3300042636 | Bacteria | 16493 |
| 83 | Ga0466708_343882 | 3300042652 | Bacteria | 22190 |
| 84 | Ga0068302_10001205 | 3300005071 | Bacteria | 11118 |
| 85 | Ga0466696_049481 | 3300042596 | Bacteria | 4718 |
| 86 | Ga0466705_482875 | 3300042612 | Bacteria | 97096 |
| 87 | Ga0466711_009482 | 3300042615 | Bacteria | 2795 |
| 88 | Ga0466715_027506 | 3300042616 | Bacteria | 1844 |
| 89 | Ga0466723_052961 | 3300042618 | Bacteria | 34600 |
| 90 | Ga0466723_108684 | 3300042618 | Bacteria | 5547 |
| 91 | Ga0466728_069540 | 3300042620 | Bacteria | 3062 |
| 92 | Ga0466706_029115 | 3300042599 | Bacteria | 1597 |
| 93 | Ga0466713_070384 | 3300042602 | Bacteria | 70651 |
| 94 | Ga0466720_001462 | 3300042607 | Bacteria | 2413 |
| 95 | Ga0466692_164362 | 3300042591 | Bacteria | 29291 |
| 96 | Ga0466705_404755 | 3300042612 | Bacteria | 1415 |
| 97 | Ga0466715_027174 | 3300042616 | Bacteria | 3383 |
| 98 | Ga0466718_068291 | 3300042617 | Bacteria | 9590 |
| 99 | Ga0466723_237466 | 3300042618 | Bacteria | 3239 |
| 100 | Ga0466728_162829 | 3300042620 | Bacteria | 3591 |
| 101 | Ga0466728_303272 | 3300042620 | Bacteria | 12729 |
| 102 | Ga0466716_432808 | 3300042605 | Bacteria | 4344 |
| 103 | Ga0466719_039503 | 3300042606 | Bacteria | 44622 |
| 104 | Ga0466722_173379 | 3300042609 | Bacteria | 1893 |
| 105 | Ga0466729_318546 | 3300042621 | Bacteria | 3476 |
| 106 | Ga0466703_251072 | 3300042636 | Bacteria | 9501 |
| 107 | Ga0466704_293065 | 3300042643 | Bacteria | 9069 |
| 108 | Ga0072941_1686446 | 3300005201 | Bacteria | 2276 |
| 109 | Ga0466705_125935 | 3300042612 | Bacteria | 6272 |
| 110 | Ga0466705_134881 | 3300042612 | Bacteria | 1282 |
| 111 | Ga0466690_194366 | 3300042590 | Bacteria | 3462 |
| 112 | Ga0466696_202325 | 3300042596 | Bacteria | 5167 |
| 113 | Ga0123356_10596723 | 3300010049 | Bacteria | 1269 |
| 114 | Ga0466723_136654 | 3300042618 | Bacteria | 9589 |
| 115 | Ga0466723_281430 | 3300042618 | Bacteria | 11562 |
| 116 | Ga0466726_166149 | 3300042619 | Unclassified | 23224 |
| 117 | Ga0466728_142504 | 3300042620 | Bacteria | 4547 |
| 118 | Ga0466729_029928 | 3300042621 | Bacteria | 10291 |
| 119 | Ga0466707_273851 | 3300042601 | Bacteria | 12721 |
| 120 | Ga0466719_008008 | 3300042606 | Bacteria | 2755 |
| 121 | Ga0466722_147023 | 3300042609 | Bacteria | 6185 |
| 122 | Ga0466704_123509 | 3300042643 | Bacteria | 6253 |
| 123 | Ga0466704_348933 | 3300042643 | Bacteria | 14770 |
| 124 | Ga0466704_590814 | 3300042643 | Bacteria | 4473 |
| 125 | Ga0466709_331844 | 3300042648 | Bacteria | 3599 |
| 126 | Ga0466727_236346 | 3300042655 | Bacteria | 4159 |
| 127 | JGI24702J35022_10006240 | 3300002462 | Bacteria | 6904 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.