Protein Family IF08280
Metagenome
Isolate
111
Members
45
Samples
110
Scaffolds
81.68
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_253594|Ga0466726_253594_1579_1872
- Length
- 97 aa
- Sequence
- MKRTEIEEIVKNFLIEEIEVDEGVIVPEAHLKDNLGIDSLDFVDIVVIVERNFGFKIKPEEMAEVSTLSQFCDYIESKVGDGFATNGTNVHEYISDN
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Kalotermitidae
28.9%
Unclassified
8.9%
Termopsidae
8.9%
Rhinotermitidae
6.7%
Passalidae
4.4%
Taxonomy
Archaea
0
Bacteria
103
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 44 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227502413 | 2225789004 | Bacteria | 19081 |
| 2 | Ga0466692_065091 | 3300042591 | Bacteria | 3741 |
| 3 | Ga0466693_001173 | 3300042592 | Bacteria | 1138 |
| 4 | Ga0466693_237481 | 3300042592 | Bacteria | 3209 |
| 5 | Ga0466707_030905 | 3300042601 | Bacteria | 1690 |
| 6 | Ga0466707_051685 | 3300042601 | Bacteria | 1846 |
| 7 | Ga0466714_015528 | 3300042603 | Bacteria | 1845 |
| 8 | Ga0466726_268086 | 3300042619 | Bacteria | 1281 |
| 9 | Ga0466728_244241 | 3300042620 | Unclassified | 1955 |
| 10 | Ga0466735_231688 | 3300042624 | Bacteria | 1667 |
| 11 | Ga0466704_343880 | 3300042643 | Bacteria | 4222 |
| 12 | Ga0466704_565068 | 3300042643 | Bacteria | 14460 |
| 13 | Ga0466708_060683 | 3300042652 | Bacteria | 49198 |
| 14 | Ga0123356_10444901 | 3300010049 | Bacteria | 1443 |
| 15 | Ga0466696_196436 | 3300042596 | Bacteria | 12458 |
| 16 | Ga0466719_217250 | 3300042606 | Bacteria | 1384 |
| 17 | Ga0466715_268412 | 3300042616 | Bacteria | 25534 |
| 18 | Ga0466734_100231 | 3300042623 | Unclassified | 1527 |
| 19 | Ga0466703_384067 | 3300042636 | Bacteria | 3714 |
| 20 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 21 | Ga0466727_270522 | 3300042655 | Bacteria | 9416 |
| 22 | Ga0068305_10078188 | 3300005083 | Bacteria | 1630 |
| 23 | Ga0123353_10560017 | 3300010167 | Bacteria | 1646 |
| 24 | Ga0123354_10148300 | 3300010882 | Bacteria | 2858 |
| 25 | Ga0466657_249935 | 3300042582 | Unclassified | 1677 |
| 26 | Ga0466693_180859 | 3300042592 | Bacteria | 1548 |
| 27 | Ga0466713_109954 | 3300042602 | Bacteria | 2628 |
| 28 | Ga0466722_021911 | 3300042609 | Bacteria | 53346 |
| 29 | Ga0466722_042797 | 3300042609 | Bacteria | 13226 |
| 30 | Ga0466726_436128 | 3300042619 | Bacteria | 3851 |
| 31 | Ga0466728_116793 | 3300042620 | Bacteria | 97907 |
| 32 | Ga0466728_149086 | 3300042620 | Bacteria | 2769 |
| 33 | Ga0466728_180366 | 3300042620 | Bacteria | 1735 |
| 34 | Ga0466703_173935 | 3300042636 | Bacteria | 16868 |
| 35 | Ga0466703_418661 | 3300042636 | Bacteria | 1739 |
| 36 | Ga0466704_102498 | 3300042643 | Bacteria | 21970 |
| 37 | Ga0466709_415522 | 3300042648 | Bacteria | 256883 |
| 38 | Ga0466724_02291 | 3300042649 | Bacteria | 3950 |
| 39 | Ga0466708_045686 | 3300042652 | Bacteria | 1320 |
| 40 | Ga0466708_081947 | 3300042652 | Unclassified | 5619 |
| 41 | Ga0466733_042701 | 3300042659 | Bacteria | 7371 |
| 42 | Ga0466733_081841 | 3300042659 | Bacteria | 24699 |
| 43 | 2227510259 | 2225789004 | Bacteria | 703 |
| 44 | Ga0068305_10921901 | 3300005083 | Bacteria | 4315 |
| 45 | Ga0123353_13137188 | 3300010167 | Bacteria | 531 |
| 46 | Ga0466700_193309 | 3300042600 | Bacteria | 37158 |
| 47 | Ga0466713_110191 | 3300042602 | Bacteria | 1850 |
| 48 | Ga0466714_007204 | 3300042603 | Bacteria | 3156 |
| 49 | Ga0466719_009948 | 3300042606 | Bacteria | 7289 |
| 50 | Ga0466719_449519 | 3300042606 | Bacteria | 14404 |
| 51 | Ga0466698_376312 | 3300042610 | Bacteria | 1877 |
| 52 | Ga0466712_274128 | 3300042614 | Bacteria | 1044 |
| 53 | Ga0466711_172638 | 3300042615 | Bacteria | 1889 |
| 54 | Ga0466715_342363 | 3300042616 | Bacteria | 29081 |
| 55 | Ga0466723_025842 | 3300042618 | Bacteria | 14881 |
| 56 | Ga0466726_093140 | 3300042619 | Bacteria | 1763 |
| 57 | Ga0466728_144522 | 3300042620 | Bacteria | 1902 |
| 58 | Ga0466728_219754 | 3300042620 | Bacteria | 1102 |
| 59 | Ga0466705_264324 | 3300042612 | Bacteria | 17030 |
| 60 | Ga0466729_201791 | 3300042621 | Bacteria | 2234 |
| 61 | Ga0466735_064037 | 3300042624 | Bacteria | 1013 |
| 62 | Ga0466727_120065 | 3300042655 | Bacteria | 6775 |
| 63 | Ga0466727_139855 | 3300042655 | Bacteria | 1514 |
| 64 | Ga0466733_090012 | 3300042659 | Bacteria | 1275 |
| 65 | JGI24696J40584_12394334 | 3300002834 | Bacteria | 552 |
| 66 | Ga0123353_10636823 | 3300010167 | Bacteria | 1513 |
| 67 | Ga0123353_10655565 | 3300010167 | Bacteria | 1485 |
| 68 | Ga0123354_10419926 | 3300010882 | Bacteria | 1112 |
| 69 | Ga0466690_015023 | 3300042590 | Bacteria | 27335 |
| 70 | Ga0466707_247099 | 3300042601 | Bacteria | 1758 |
| 71 | Ga0466710_409546 | 3300042613 | Bacteria | 3499 |
| 72 | Ga0466726_253594 | 3300042619 | Bacteria | 4177 |
| 73 | Ga0466729_002924 | 3300042621 | Bacteria | 1129 |
| 74 | Ga0466735_136477 | 3300042624 | Bacteria | 4861 |
| 75 | Ga0466703_374000 | 3300042636 | Bacteria | 1062 |
| 76 | 2227463515 | 2225789004 | Bacteria | 25666 |
| 77 | JGI24696J40584_12947932 | 3300002834 | Unclassified | 1976 |
| 78 | JGI24696J40584_12959541 | 3300002834 | Bacteria | 5263 |
| 79 | Ga0068302_10145766 | 3300005071 | Unclassified | 2018 |
| 80 | Ga0068305_11157152 | 3300005083 | Bacteria | 685 |
| 81 | Ga0123357_10047035 | 3300009784 | Bacteria | 5849 |
| 82 | Ga0123353_10086243 | 3300010167 | Bacteria | 5056 |
| 83 | Ga0123353_11812260 | 3300010167 | Bacteria | 758 |
| 84 | Ga0466716_202600 | 3300042605 | Bacteria | 25648 |
| 85 | Ga0466710_118153 | 3300042613 | Bacteria | 8201 |
| 86 | Ga0466715_440572 | 3300042616 | Bacteria | 3452 |
| 87 | Ga0466726_473481 | 3300042619 | Bacteria | 4648 |
| 88 | Ga0466728_046855 | 3300042620 | Bacteria | 21751 |
| 89 | Ga0466709_315607 | 3300042648 | Bacteria | 6478 |
| 90 | JGI24702J35022_10005639 | 3300002462 | Unclassified | 7297 |
| 91 | JGI24702J35022_10011745 | 3300002462 | Bacteria | 4879 |
| 92 | JGI24702J35022_10013784 | 3300002462 | Bacteria | 4469 |
| 93 | JGI24702J35022_10020359 | 3300002462 | Bacteria | 3602 |
| 94 | JGI24702J35022_10412441 | 3300002462 | Bacteria | 817 |
| 95 | JGI24696J40584_12911985 | 3300002834 | Unclassified | 1264 |
| 96 | Ga0123354_10556645 | 3300010882 | Bacteria | 862 |
| 97 | Ga0466715_404214 | 3300042616 | Bacteria | 35013 |
| 98 | Ga0466715_604151 | 3300042616 | Bacteria | 27450 |
| 99 | Ga0466697_187222 | 3300042611 | Bacteria | 1407 |
| 100 | 2227485820 | 2225789004 | Bacteria | 820 |
| 101 | IMNBL1DRAFT_c0002369 | 3300000062 | Bacteria | 13182 |
| 102 | Ga0123356_10954886 | 3300010049 | Bacteria | 1028 |
| 103 | Ga0466693_272559 | 3300042592 | Bacteria | 1440 |
| 104 | Ga0466701_001524 | 3300042598 | Bacteria | 26824 |
| 105 | Ga0466707_178131 | 3300042601 | Bacteria | 2955 |
| 106 | Ga0466722_265049 | 3300042609 | Bacteria | 14900 |
| 107 | Ga0466698_298865 | 3300042610 | Bacteria | 2952 |
| 108 | Ga0466712_156563 | 3300042614 | Bacteria | 1133 |
| 109 | Ga0466731_215946 | 3300042622 | Bacteria | 2635 |
| 110 | Ga0466735_015738 | 3300042624 | Bacteria | 11240 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00550 | PP-binding | Phosphopantetheine attachment site | 10 | 75 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.