Protein Family IF08263
Metagenome
Isolate
141
Members
43
Samples
133
Scaffolds
193.4
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_217236|Ga0466726_217236_59453_60091
- Length
- 212 aa
- Sequence
- VLLVWVFHLYVCDIKGVLMMSAKMIEIRWHGRGGQGAKTAALLFAEVVLATGKHIQAFPEYGPERMGAPVQAFNRISDENITIHSGITNPDYVVILDPSLMESVEVIDGVGEIGKVIVNTSFTVAKIAQKLGIKESQIYVVNASQIALETIGKDIPNTPMLGGLVKVIGTLDINSVLEDIKGKLMSKFRHKPEIIDGNVKSIKRAFDEVKNR
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.0%
Unclassified
26.2%
Termitidae
23.8%
Termopsidae
9.5%
Rhinotermitidae
4.8%
Passalidae
2.4%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 10 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 11 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_048869 | 3300042613 | Bacteria | 1199 |
| 2 | Ga0466715_163831 | 3300042616 | Bacteria | 66780 |
| 3 | Ga0466723_305406 | 3300042618 | Unclassified | 3141 |
| 4 | Ga0466726_229723 | 3300042619 | Bacteria | 11448 |
| 5 | Ga0466726_435703 | 3300042619 | Bacteria | 1321 |
| 6 | Ga0466690_401128 | 3300042590 | Bacteria | 8215 |
| 7 | Ga0123353_10000467 | 3300010167 | Bacteria | 50553 |
| 8 | Ga0466735_013528 | 3300042624 | Bacteria | 15782 |
| 9 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 10 | Ga0466704_282522 | 3300042643 | Unclassified | 12374 |
| 11 | Ga0466709_217350 | 3300042648 | Bacteria | 27425 |
| 12 | Ga0466727_059455 | 3300042655 | Bacteria | 175715 |
| 13 | Ga0466706_010205 | 3300042599 | Bacteria | 97987 |
| 14 | Ga0466706_037575 | 3300042599 | Bacteria | 87054 |
| 15 | Ga0466713_009206 | 3300042602 | Bacteria | 8464 |
| 16 | Ga0466713_024871 | 3300042602 | Bacteria | 17138 |
| 17 | Ga0466705_463812 | 3300042612 | Bacteria | 8007 |
| 18 | Ga0466711_072268 | 3300042615 | Bacteria | 16190 |
| 19 | Ga0466723_351486 | 3300042618 | Bacteria | 3625 |
| 20 | Ga0466729_016394 | 3300042621 | Bacteria | 6635 |
| 21 | Ga0466693_222853 | 3300042592 | Bacteria | 3744 |
| 22 | Ga0466696_069943 | 3300042596 | Bacteria | 19845 |
| 23 | Ga0466735_013899 | 3300042624 | Bacteria | 1484 |
| 24 | Ga0466735_027740 | 3300042624 | Bacteria | 1055 |
| 25 | Ga0466735_071145 | 3300042624 | Bacteria | 4458 |
| 26 | Ga0466703_003589 | 3300042636 | Unclassified | 3709 |
| 27 | Ga0466706_217033 | 3300042599 | Bacteria | 132615 |
| 28 | Ga0466713_089799 | 3300042602 | Bacteria | 8648 |
| 29 | Ga0466716_137771 | 3300042605 | Bacteria | 19371 |
| 30 | Ga0068302_10032838 | 3300005071 | Bacteria | 3103 |
| 31 | Ga0072941_1146420 | 3300005201 | Bacteria | 3385 |
| 32 | Ga0466726_041114 | 3300042619 | Bacteria | 30700 |
| 33 | Ga0466726_115500 | 3300042619 | Bacteria | 71251 |
| 34 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 35 | Ga0466726_293088 | 3300042619 | Bacteria | 1402 |
| 36 | Ga0466690_048667 | 3300042590 | Unclassified | 4006 |
| 37 | Ga0466690_309270 | 3300042590 | Bacteria | 28660 |
| 38 | Ga0466729_202955 | 3300042621 | Bacteria | 12259 |
| 39 | Ga0466735_074455 | 3300042624 | Bacteria | 27644 |
| 40 | Ga0466735_153156 | 3300042624 | Bacteria | 11109 |
| 41 | Ga0466735_185288 | 3300042624 | Unclassified | 7397 |
| 42 | Ga0466704_086571 | 3300042643 | Bacteria | 65985 |
| 43 | Ga0466727_067057 | 3300042655 | Bacteria | 7765 |
| 44 | Ga0466713_148925 | 3300042602 | Bacteria | 109604 |
| 45 | Ga0466714_064782 | 3300042603 | Bacteria | 70661 |
| 46 | Ga0466716_246458 | 3300042605 | Bacteria | 14023 |
| 47 | Ga0466719_014293 | 3300042606 | Unclassified | 12744 |
| 48 | JGI24702J35022_10000059 | 3300002462 | Bacteria | 46281 |
| 49 | Ga0068305_10000090 | 3300005083 | Bacteria | 152414 |
| 50 | Ga0466705_187150 | 3300042612 | Unclassified | 3476 |
| 51 | Ga0466715_103093 | 3300042616 | Bacteria | 32574 |
| 52 | Ga0466715_464428 | 3300042616 | Bacteria | 2260 |
| 53 | Ga0466718_057353 | 3300042617 | Unclassified | 12564 |
| 54 | Ga0466723_276653 | 3300042618 | Bacteria | 86412 |
| 55 | Ga0466723_350099 | 3300042618 | Bacteria | 10749 |
| 56 | Ga0466726_219448 | 3300042619 | Bacteria | 3246 |
| 57 | Ga0466728_003045 | 3300042620 | Bacteria | 90142 |
| 58 | Ga0466728_417467 | 3300042620 | Bacteria | 43739 |
| 59 | Ga0466729_138882 | 3300042621 | Bacteria | 1908 |
| 60 | Ga0466690_246607 | 3300042590 | Bacteria | 5762 |
| 61 | Ga0466690_324640 | 3300042590 | Unclassified | 4856 |
| 62 | Ga0123357_10006932 | 3300009784 | Bacteria | 13921 |
| 63 | Ga0466735_062663 | 3300042624 | Unclassified | 1459 |
| 64 | Ga0466735_062677 | 3300042624 | Bacteria | 17462 |
| 65 | Ga0466735_202494 | 3300042624 | Bacteria | 11764 |
| 66 | Ga0466704_596461 | 3300042643 | Bacteria | 93141 |
| 67 | Ga0466707_082963 | 3300042601 | Unclassified | 1094 |
| 68 | Ga0466707_127045 | 3300042601 | Bacteria | 82449 |
| 69 | Ga0466719_005808 | 3300042606 | Bacteria | 6406 |
| 70 | Ga0466711_157498 | 3300042615 | Bacteria | 313285 |
| 71 | Ga0466711_190200 | 3300042615 | Bacteria | 3480 |
| 72 | Ga0466723_061356 | 3300042618 | Bacteria | 3229 |
| 73 | Ga0466728_334452 | 3300042620 | Bacteria | 73486 |
| 74 | Ga0466729_155428 | 3300042621 | Bacteria | 41381 |
| 75 | Ga0466691_015920 | 3300042593 | Bacteria | 62881 |
| 76 | Ga0466735_023872 | 3300042624 | Bacteria | 8242 |
| 77 | Ga0466704_095429 | 3300042643 | Bacteria | 32723 |
| 78 | Ga0466704_270377 | 3300042643 | Bacteria | 7319 |
| 79 | Ga0466727_271147 | 3300042655 | Bacteria | 176023 |
| 80 | Ga0466707_237788 | 3300042601 | Bacteria | 14513 |
| 81 | Ga0068302_10016289 | 3300005071 | Unclassified | 4443 |
| 82 | Ga0466705_143986 | 3300042612 | Bacteria | 113378 |
| 83 | Ga0466712_236422 | 3300042614 | Bacteria | 1383 |
| 84 | Ga0466715_602591 | 3300042616 | Bacteria | 13927 |
| 85 | Ga0466726_395759 | 3300042619 | Bacteria | 8049 |
| 86 | Ga0466726_400574 | 3300042619 | Bacteria | 12909 |
| 87 | Ga0466729_015754 | 3300042621 | Bacteria | 6777 |
| 88 | Ga0466729_119788 | 3300042621 | Bacteria | 59579 |
| 89 | Ga0466735_235213 | 3300042624 | Bacteria | 12597 |
| 90 | Ga0466704_551659 | 3300042643 | Unclassified | 1358 |
| 91 | Ga0466727_017964 | 3300042655 | Unclassified | 1672 |
| 92 | Ga0466727_214209 | 3300042655 | Bacteria | 66628 |
| 93 | Ga0466706_166478 | 3300042599 | Bacteria | 103376 |
| 94 | Ga0466707_296529 | 3300042601 | Bacteria | 3870 |
| 95 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 96 | JGI24705J35276_12238808 | 3300002504 | Bacteria | 121301 |
| 97 | Ga0068302_10068148 | 3300005071 | Bacteria | 4342 |
| 98 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 99 | Ga0466705_137618 | 3300042612 | Bacteria | 19455 |
| 100 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 101 | Ga0466715_098538 | 3300042616 | Bacteria | 131452 |
| 102 | Ga0466691_005214 | 3300042593 | Unclassified | 3568 |
| 103 | Ga0123357_10033735 | 3300009784 | Bacteria | 6958 |
| 104 | Ga0123353_11233160 | 3300010167 | Bacteria | 978 |
| 105 | Ga0466735_061923 | 3300042624 | Bacteria | 10833 |
| 106 | Ga0466735_063588 | 3300042624 | Bacteria | 1406 |
| 107 | Ga0466703_002301 | 3300042636 | Bacteria | 33125 |
| 108 | Ga0466704_026920 | 3300042643 | Unclassified | 5134 |
| 109 | Ga0466727_322139 | 3300042655 | Bacteria | 101886 |
| 110 | Ga0466706_155976 | 3300042599 | Bacteria | 20238 |
| 111 | Ga0466707_031574 | 3300042601 | Bacteria | 5078 |
| 112 | Ga0466707_141553 | 3300042601 | Bacteria | 8298 |
| 113 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 114 | 2227487433 | 2225789004 | Bacteria | 4198 |
| 115 | Ga0068302_10032860 | 3300005071 | Bacteria | 6812 |
| 116 | Ga0068305_10003706 | 3300005083 | Unclassified | 16582 |
| 117 | Ga0466705_426510 | 3300042612 | Unclassified | 13528 |
| 118 | Ga0466711_242327 | 3300042615 | Bacteria | 45441 |
| 119 | Ga0466711_353417 | 3300042615 | Bacteria | 10016 |
| 120 | Ga0466715_006925 | 3300042616 | Bacteria | 24708 |
| 121 | Ga0466715_135271 | 3300042616 | Bacteria | 38838 |
| 122 | Ga0466715_289200 | 3300042616 | Unclassified | 3460 |
| 123 | Ga0466726_100940 | 3300042619 | Bacteria | 1689 |
| 124 | Ga0466726_383206 | 3300042619 | Unclassified | 5067 |
| 125 | Ga0466728_089839 | 3300042620 | Bacteria | 15970 |
| 126 | Ga0466696_452776 | 3300042596 | Bacteria | 6688 |
| 127 | Ga0123356_10000082 | 3300010049 | Bacteria | 101862 |
| 128 | Ga0466735_057599 | 3300042624 | Bacteria | 16673 |
| 129 | Ga0466704_448201 | 3300042643 | Bacteria | 6498 |
| 130 | Ga0466706_101820 | 3300042599 | Bacteria | 1433 |
| 131 | Ga0466707_096790 | 3300042601 | Bacteria | 31095 |
| 132 | Ga0466722_131165 | 3300042609 | Bacteria | 4278 |
| 133 | Ga0068305_10000309 | 3300005083 | Bacteria | 29885 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01558 | POR | Pyruvate ferredoxin/flavodoxin oxidoreductase | 33 | 206 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01558 | GO:0016903 | oxidoreductase activity, acting on the aldehyde or oxo group of donors | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.