Protein Family IF08214
Metagenome
Isolate
129
Members
34
Samples
126
Scaffolds
324.15
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_076936|Ga0466726_076936_334_1476
- Length
- 380 aa
- Sequence
- MIDLSNQKTGKMAIAASMHFEFCPAAFKHGITEASIRYAFLNPLFDGPTDHLTGEPILISIENMSDNNAEFLILGAGPAGLSAAQYGARANLKVLVVEQMAPGGQALTIDVLENYPGNVARGDTPPLTGFEFSQDLHRQAETFGARFIMEGAAGIAREGDSFVVNLSGGTTLRAPALLLASGALRRKLDVPGETEWYGRGVSYCATCDGPFFKGKRILVVGGGDAACDEAQYLSRLSDKVILVHRKSMFRAQKSLAERTLANPHIEVRFNTRLLEIKGDKKVASVLLEGPRDGGEIIPYEESIDAVFIFAGSTPQSVLAKDLGVKLDEAGYVITDQAMATSVRGFFAAGDVRSSPFRQVVVAAGEGAIAAHCAAEYISSL
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
43.8%
Termitidae
28.1%
Rhinotermitidae
9.4%
Unclassified
9.4%
Termopsidae
9.4%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_019379 | 3300042612 | Bacteria | 5260 |
| 2 | Ga0072941_1000038 | 3300005201 | Bacteria | 14911 |
| 3 | Ga0072941_1001002 | 3300005201 | Bacteria | 23705 |
| 4 | Ga0466718_026586 | 3300042617 | Bacteria | 13284 |
| 5 | Ga0466718_127721 | 3300042617 | Bacteria | 5623 |
| 6 | Ga0466723_128030 | 3300042618 | Bacteria | 26554 |
| 7 | Ga0466723_353380 | 3300042618 | Bacteria | 2122 |
| 8 | Ga0466726_076936 | 3300042619 | Bacteria | 2080 |
| 9 | Ga0466716_087969 | 3300042605 | Bacteria | 4182 |
| 10 | Ga0466716_093477 | 3300042605 | Bacteria | 8098 |
| 11 | Ga0466719_128996 | 3300042606 | Bacteria | 1442 |
| 12 | Ga0466698_295445 | 3300042610 | Bacteria | 2764 |
| 13 | Ga0466702_240224 | 3300042635 | Bacteria | 13531 |
| 14 | Ga0466703_062086 | 3300042636 | Bacteria | 35310 |
| 15 | Ga0466708_083140 | 3300042652 | Bacteria | 34789 |
| 16 | Ga0466727_258137 | 3300042655 | Bacteria | 3144 |
| 17 | AustNasuHG_c1005672 | 3300000089 | Bacteria | 4466 |
| 18 | Ga0072941_1012693 | 3300005201 | Bacteria | 23974 |
| 19 | Ga0466690_219161 | 3300042590 | Bacteria | 5975 |
| 20 | Ga0466691_045852 | 3300042593 | Bacteria | 2095 |
| 21 | Ga0466711_233902 | 3300042615 | Bacteria | 21769 |
| 22 | Ga0466711_393717 | 3300042615 | Bacteria | 9538 |
| 23 | Ga0466718_055146 | 3300042617 | Bacteria | 2232 |
| 24 | Ga0466728_122820 | 3300042620 | Bacteria | 13543 |
| 25 | Ga0466708_035814 | 3300042652 | Bacteria | 4726 |
| 26 | Ga0466708_369443 | 3300042652 | Bacteria | 17120 |
| 27 | Ga0466705_337054 | 3300042612 | Bacteria | 1953 |
| 28 | Ga0466690_406218 | 3300042590 | Bacteria | 4406 |
| 29 | Ga0466696_034159 | 3300042596 | Bacteria | 13370 |
| 30 | Ga0123353_10297256 | 3300010167 | Bacteria | 2468 |
| 31 | Ga0466711_306143 | 3300042615 | Bacteria | 4346 |
| 32 | Ga0466718_029946 | 3300042617 | Bacteria | 5031 |
| 33 | Ga0466723_116947 | 3300042618 | Bacteria | 88879 |
| 34 | Ga0466723_359994 | 3300042618 | Bacteria | 11936 |
| 35 | Ga0466716_088306 | 3300042605 | Bacteria | 10529 |
| 36 | Ga0466719_052414 | 3300042606 | Bacteria | 13658 |
| 37 | Ga0466735_144318 | 3300042624 | Bacteria | 1302 |
| 38 | Ga0466704_018469 | 3300042643 | Bacteria | 1254 |
| 39 | Ga0466704_169836 | 3300042643 | Bacteria | 5526 |
| 40 | Ga0466704_533080 | 3300042643 | Bacteria | 39781 |
| 41 | Ga0466709_013258 | 3300042648 | Unclassified | 5342 |
| 42 | Ga0466709_057755 | 3300042648 | Bacteria | 7617 |
| 43 | Ga0466708_035859 | 3300042652 | Bacteria | 41234 |
| 44 | Ga0466708_094415 | 3300042652 | Bacteria | 8131 |
| 45 | Ga0466708_368162 | 3300042652 | Bacteria | 11090 |
| 46 | JGI24698J34947_10105744 | 3300002449 | Bacteria | 1254 |
| 47 | Ga0072941_1091121 | 3300005201 | Bacteria | 2195 |
| 48 | Ga0466690_285642 | 3300042590 | Unclassified | 16061 |
| 49 | Ga0466696_389043 | 3300042596 | Bacteria | 1347 |
| 50 | Ga0466711_222607 | 3300042615 | Bacteria | 5235 |
| 51 | Ga0466715_153644 | 3300042616 | Bacteria | 3920 |
| 52 | Ga0466715_316046 | 3300042616 | Bacteria | 4057 |
| 53 | Ga0466718_063583 | 3300042617 | Bacteria | 6793 |
| 54 | Ga0466718_151555 | 3300042617 | Bacteria | 17973 |
| 55 | Ga0466718_155839 | 3300042617 | Bacteria | 14999 |
| 56 | Ga0466716_012013 | 3300042605 | Bacteria | 1698 |
| 57 | Ga0466722_128753 | 3300042609 | Bacteria | 10433 |
| 58 | Ga0466722_154024 | 3300042609 | Bacteria | 20907 |
| 59 | Ga0466709_404832 | 3300042648 | Bacteria | 1442 |
| 60 | Ga0072941_1000180 | 3300005201 | Bacteria | 54954 |
| 61 | Ga0466690_229942 | 3300042590 | Bacteria | 13697 |
| 62 | Ga0466692_061766 | 3300042591 | Bacteria | 11909 |
| 63 | Ga0466691_031667 | 3300042593 | Bacteria | 7103 |
| 64 | Ga0466696_026868 | 3300042596 | Bacteria | 8813 |
| 65 | Ga0466699_329736 | 3300042597 | Bacteria | 1231 |
| 66 | Ga0466711_087762 | 3300042615 | Bacteria | 4533 |
| 67 | Ga0466723_035249 | 3300042618 | Bacteria | 15913 |
| 68 | Ga0466723_210854 | 3300042618 | Bacteria | 1967 |
| 69 | Ga0466726_251417 | 3300042619 | Bacteria | 1995 |
| 70 | Ga0466722_072741 | 3300042609 | Bacteria | 2661 |
| 71 | Ga0466722_196308 | 3300042609 | Bacteria | 30459 |
| 72 | Ga0466703_191246 | 3300042636 | Bacteria | 6355 |
| 73 | Ga0466704_022603 | 3300042643 | Bacteria | 6714 |
| 74 | Ga0466704_081390 | 3300042643 | Bacteria | 8258 |
| 75 | Ga0466709_009016 | 3300042648 | Bacteria | 9546 |
| 76 | Ga0466709_019236 | 3300042648 | Bacteria | 18315 |
| 77 | Ga0466705_168935 | 3300042612 | Bacteria | 6471 |
| 78 | Ga0466732_178490 | 3300042656 | Bacteria | 1544 |
| 79 | Ga0466692_069882 | 3300042591 | Bacteria | 61867 |
| 80 | Ga0466696_235028 | 3300042596 | Bacteria | 15062 |
| 81 | Ga0466711_473947 | 3300042615 | Bacteria | 2589 |
| 82 | Ga0466715_335419 | 3300042616 | Bacteria | 4022 |
| 83 | Ga0466718_053065 | 3300042617 | Bacteria | 2019 |
| 84 | Ga0466723_034802 | 3300042618 | Bacteria | 4711 |
| 85 | Ga0466723_140724 | 3300042618 | Bacteria | 42677 |
| 86 | Ga0466728_090500 | 3300042620 | Bacteria | 15311 |
| 87 | Ga0466728_311772 | 3300042620 | Bacteria | 5159 |
| 88 | Ga0466716_143028 | 3300042605 | Bacteria | 1938 |
| 89 | Ga0466719_053337 | 3300042606 | Unclassified | 8845 |
| 90 | Ga0466719_266929 | 3300042606 | Bacteria | 24531 |
| 91 | Ga0466698_476948 | 3300042610 | Bacteria | 1779 |
| 92 | Ga0466709_270765 | 3300042648 | Bacteria | 11257 |
| 93 | Ga0466727_049560 | 3300042655 | Bacteria | 1389 |
| 94 | Ga0466705_318964 | 3300042612 | Bacteria | 2876 |
| 95 | Ga0456237_0002633 | 3300041968 | Bacteria | 2899 |
| 96 | Ga0466691_035009 | 3300042593 | Bacteria | 9097 |
| 97 | Ga0466691_104347 | 3300042593 | Bacteria | 19831 |
| 98 | Ga0466691_223366 | 3300042593 | Bacteria | 12376 |
| 99 | Ga0466696_179235 | 3300042596 | Bacteria | 7060 |
| 100 | Ga0466711_099590 | 3300042615 | Bacteria | 3069 |
| 101 | Ga0466715_260645 | 3300042616 | Bacteria | 28966 |
| 102 | Ga0466718_157935 | 3300042617 | Bacteria | 7797 |
| 103 | Ga0466723_026309 | 3300042618 | Bacteria | 18891 |
| 104 | Ga0466723_065503 | 3300042618 | Bacteria | 10421 |
| 105 | Ga0466716_035400 | 3300042605 | Bacteria | 6562 |
| 106 | Ga0466719_454107 | 3300042606 | Bacteria | 3392 |
| 107 | Ga0466722_135944 | 3300042609 | Bacteria | 1273 |
| 108 | Ga0466703_192749 | 3300042636 | Bacteria | 5755 |
| 109 | Ga0466703_270247 | 3300042636 | Bacteria | 9958 |
| 110 | Ga0466704_067158 | 3300042643 | Bacteria | 9669 |
| 111 | Ga0466727_139887 | 3300042655 | Bacteria | 1528 |
| 112 | Ga0072940_1057983 | 3300005200 | Bacteria | 1893 |
| 113 | Ga0072940_1067237 | 3300005200 | Bacteria | 3535 |
| 114 | Ga0264413_118048 | 3300024493 | Bacteria | 1698 |
| 115 | Ga0466696_006315 | 3300042596 | Bacteria | 5215 |
| 116 | Ga0466696_037428 | 3300042596 | Bacteria | 12157 |
| 117 | Ga0466715_316742 | 3300042616 | Bacteria | 5931 |
| 118 | Ga0466726_421378 | 3300042619 | Bacteria | 1045 |
| 119 | Ga0466722_162417 | 3300042609 | Bacteria | 9035 |
| 120 | Ga0466722_189156 | 3300042609 | Bacteria | 5236 |
| 121 | Ga0466703_329467 | 3300042636 | Bacteria | 6198 |
| 122 | Ga0466704_158088 | 3300042643 | Bacteria | 7308 |
| 123 | Ga0466708_083826 | 3300042652 | Bacteria | 27482 |
| 124 | Ga0466727_166146 | 3300042655 | Bacteria | 11481 |
| 125 | Ga0466727_310191 | 3300042655 | Bacteria | 4465 |
| 126 | Ga0466727_344691 | 3300042655 | Bacteria | 1284 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00070 | Pyr_redox | Pyridine nucleotide-disulphide oxidoreductase | 216 | 288 | 0.92 |
| PF07992 | Pyr_redox_2 | Pyridine nucleotide-disulphide oxidoreductase | 72 | 366 | 0.9 |
| PF01946 | Thi4 | Thi4 family | 69 | 105 | 0.87 |
| PF13450 | NAD_binding_8 | NAD(P)-binding Rossmann-like domain | 73 | 117 | 0.85 |
| PF13738 | Pyr_redox_3 | Pyridine nucleotide-disulphide oxidoreductase | 154 | 349 | 0.77 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07992 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.