Protein Family IF08212
Metagenome
Isolate
128
Members
44
Samples
125
Scaffolds
260.29
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_069480|Ga0466726_069480_9791_10660
- Length
- 289 aa
- Sequence
- MRTGTTNDDSEECPGKKGVFMAATPQDIITAKLFFNAAFPVMKVVLEDDPAMKAKFQDVKAVVQIGAKNPGGNGGEEFLACHLVFNKGEFQVILGPAEKPDIVLSFPTVAKMNTMFRGGAALPAIKGFGKLGLLLKVFSLLMSLMIMMPGSRPKDPVKRRLKVKMSLYMVSRALSVYNKLGNPEMAEWCKRQPDRIYQFVVDKPGSSEPEIACYLRVKAGKSKSGHGVYARRRPFVLFHFFNVDGALKVLLKDVGFVQGVEEGCVEVVGSPEYAMNLNDFMAILQGMLT
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.9%
Kalotermitidae
31.8%
Unclassified
13.6%
Termopsidae
6.8%
Rhinotermitidae
4.5%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 36 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_038845 | 3300038395 | Bacteria | 2736 |
| 2 | Ga0466693_358918 | 3300042592 | Unclassified | 1769 |
| 3 | Ga0466691_115443 | 3300042593 | Bacteria | 13963 |
| 4 | Ga0466699_202301 | 3300042597 | Unclassified | 1151 |
| 5 | Ga0466735_014604 | 3300042624 | Bacteria | 2326 |
| 6 | Ga0466709_258735 | 3300042648 | Bacteria | 25998 |
| 7 | Ga0466716_100842 | 3300042605 | Bacteria | 3843 |
| 8 | Ga0466711_195788 | 3300042615 | Bacteria | 43179 |
| 9 | Ga0466732_038600 | 3300042656 | Bacteria | 2766 |
| 10 | Ga0466690_425403 | 3300042590 | Unclassified | 1166 |
| 11 | Ga0466695_280829 | 3300042595 | Bacteria | 2401 |
| 12 | Ga0466704_028477 | 3300042643 | Bacteria | 15476 |
| 13 | Ga0466704_594897 | 3300042643 | Bacteria | 5615 |
| 14 | Ga0466709_193050 | 3300042648 | Bacteria | 5694 |
| 15 | Ga0466716_311125 | 3300042605 | Bacteria | 3983 |
| 16 | Ga0466719_052505 | 3300042606 | Bacteria | 2406 |
| 17 | Ga0466722_181203 | 3300042609 | Bacteria | 46889 |
| 18 | Ga0123353_10311267 | 3300010167 | Bacteria | 2396 |
| 19 | JGI24702J35022_10179995 | 3300002462 | Unclassified | 1200 |
| 20 | Ga0466705_410542 | 3300042612 | Bacteria | 3038 |
| 21 | Ga0466712_005251 | 3300042614 | Bacteria | 6040 |
| 22 | Ga0466711_077314 | 3300042615 | Bacteria | 6016 |
| 23 | Ga0466715_063064 | 3300042616 | Bacteria | 2589 |
| 24 | Ga0466726_069480 | 3300042619 | Bacteria | 23044 |
| 25 | Ga0466690_232729 | 3300042590 | Bacteria | 4653 |
| 26 | Ga0466692_180232 | 3300042591 | Bacteria | 17562 |
| 27 | Ga0466695_367109 | 3300042595 | Bacteria | 3109 |
| 28 | Ga0466703_192023 | 3300042636 | Bacteria | 1677 |
| 29 | Ga0466704_097597 | 3300042643 | Bacteria | 2251 |
| 30 | Ga0466704_227433 | 3300042643 | Bacteria | 15202 |
| 31 | Ga0466709_102081 | 3300042648 | Bacteria | 3753 |
| 32 | Ga0466708_204688 | 3300042652 | Unclassified | 3887 |
| 33 | Ga0466716_067556 | 3300042605 | Bacteria | 9999 |
| 34 | Ga0466719_039352 | 3300042606 | Bacteria | 19876 |
| 35 | Ga0123356_10546428 | 3300010049 | Bacteria | 1319 |
| 36 | Ga0123353_10118256 | 3300010167 | Bacteria | 4262 |
| 37 | Ga0123353_10646094 | 3300010167 | Bacteria | 1499 |
| 38 | JGI24702J35022_10006608 | 3300002462 | Bacteria | 6696 |
| 39 | JGI24702J35022_10124453 | 3300002462 | Bacteria | 1426 |
| 40 | Ga0466715_061446 | 3300042616 | Bacteria | 3089 |
| 41 | Ga0466723_043166 | 3300042618 | Bacteria | 9301 |
| 42 | Ga0466691_102941 | 3300042593 | Bacteria | 2766 |
| 43 | Ga0466691_186489 | 3300042593 | Unclassified | 3511 |
| 44 | Ga0466694_354300 | 3300042594 | Unclassified | 1024 |
| 45 | Ga0466708_463540 | 3300042652 | Bacteria | 1447 |
| 46 | Ga0466717_084737 | 3300042604 | Unclassified | 1562 |
| 47 | Ga0466716_055043 | 3300042605 | Bacteria | 7503 |
| 48 | Ga0123353_10824501 | 3300010167 | Unclassified | 1276 |
| 49 | Ga0123353_10910514 | 3300010167 | Bacteria | 1196 |
| 50 | AustNasuHG_c1003344 | 3300000089 | Bacteria | 5789 |
| 51 | JGI24695J34938_10006985 | 3300002450 | Bacteria | 6691 |
| 52 | JGI24705J35276_12221881 | 3300002504 | Bacteria | 2375 |
| 53 | Ga0466711_391543 | 3300042615 | Bacteria | 1720 |
| 54 | Ga0466718_091528 | 3300042617 | Bacteria | 1689 |
| 55 | Ga0466718_123069 | 3300042617 | Bacteria | 3075 |
| 56 | Ga0466723_085947 | 3300042618 | Bacteria | 4622 |
| 57 | Ga0466705_111372 | 3300042612 | Unclassified | 7889 |
| 58 | Ga0466690_009121 | 3300042590 | Bacteria | 15585 |
| 59 | Ga0466692_028867 | 3300042591 | Bacteria | 7409 |
| 60 | Ga0466696_010817 | 3300042596 | Bacteria | 8867 |
| 61 | Ga0466696_011364 | 3300042596 | Bacteria | 2550 |
| 62 | Ga0466703_109964 | 3300042636 | Bacteria | 17314 |
| 63 | Ga0466708_194271 | 3300042652 | Unclassified | 1556 |
| 64 | Ga0466707_015357 | 3300042601 | Bacteria | 1778 |
| 65 | Ga0466716_063828 | 3300042605 | Bacteria | 8565 |
| 66 | Ga0123353_10962299 | 3300010167 | Bacteria | 1153 |
| 67 | JGI24702J35022_10010554 | 3300002462 | Bacteria | 5158 |
| 68 | JGI24702J35022_10053145 | 3300002462 | Unclassified | 2160 |
| 69 | Ga0068305_10003725 | 3300005083 | Bacteria | 4525 |
| 70 | Ga0466712_013711 | 3300042614 | Unclassified | 1209 |
| 71 | Ga0466726_072398 | 3300042619 | Unclassified | 2471 |
| 72 | Ga0466728_417071 | 3300042620 | Bacteria | 5139 |
| 73 | Ga0466705_172961 | 3300042612 | Bacteria | 2169 |
| 74 | Ga0466705_179579 | 3300042612 | Bacteria | 4282 |
| 75 | Ga0466690_189918 | 3300042590 | Bacteria | 9315 |
| 76 | Ga0466691_004379 | 3300042593 | Bacteria | 27826 |
| 77 | Ga0466696_189438 | 3300042596 | Unclassified | 24789 |
| 78 | Ga0466708_021866 | 3300042652 | Bacteria | 13432 |
| 79 | Ga0466727_236378 | 3300042655 | Unclassified | 6530 |
| 80 | Ga0466706_018505 | 3300042599 | Unclassified | 1164 |
| 81 | Ga0466706_075389 | 3300042599 | Bacteria | 11175 |
| 82 | Ga0466707_409800 | 3300042601 | Bacteria | 2051 |
| 83 | Ga0466713_148635 | 3300042602 | Bacteria | 2378 |
| 84 | Ga0466719_498156 | 3300042606 | Bacteria | 69594 |
| 85 | Ga0123353_10043080 | 3300010167 | Bacteria | 7148 |
| 86 | JGI24702J35022_10010186 | 3300002462 | Bacteria | 5264 |
| 87 | Ga0466711_011926 | 3300042615 | Bacteria | 2651 |
| 88 | Ga0466711_324323 | 3300042615 | Bacteria | 4705 |
| 89 | Ga0466715_000382 | 3300042616 | Bacteria | 6068 |
| 90 | Ga0466715_458818 | 3300042616 | Unclassified | 3210 |
| 91 | Ga0466723_023716 | 3300042618 | Bacteria | 23982 |
| 92 | Ga0466723_029142 | 3300042618 | Bacteria | 3622 |
| 93 | Ga0466728_011064 | 3300042620 | Bacteria | 2837 |
| 94 | Ga0415639_114175 | 3300038395 | Bacteria | 1810 |
| 95 | Ga0466691_067175 | 3300042593 | Bacteria | 9703 |
| 96 | Ga0466691_128820 | 3300042593 | Bacteria | 5000 |
| 97 | Ga0466696_266448 | 3300042596 | Bacteria | 23351 |
| 98 | Ga0466703_188982 | 3300042636 | Unclassified | 1846 |
| 99 | Ga0466700_255941 | 3300042600 | Bacteria | 2452 |
| 100 | Ga0466722_049863 | 3300042609 | Bacteria | 3533 |
| 101 | Ga0466722_124768 | 3300042609 | Bacteria | 11230 |
| 102 | Ga0466698_240409 | 3300042610 | Unclassified | 1245 |
| 103 | Ga0123356_10000331 | 3300010049 | Bacteria | 54509 |
| 104 | Ga0123356_10718413 | 3300010049 | Bacteria | 1168 |
| 105 | Ga0123353_10262731 | 3300010167 | Bacteria | 2665 |
| 106 | Ga0123353_10619721 | 3300010167 | Bacteria | 1541 |
| 107 | JGI24698J34947_10002698 | 3300002449 | Bacteria | 9577 |
| 108 | JGI24702J35022_10059845 | 3300002462 | Unclassified | 2035 |
| 109 | Ga0466711_120404 | 3300042615 | Bacteria | 15432 |
| 110 | Ga0466715_136168 | 3300042616 | Bacteria | 23992 |
| 111 | Ga0466723_050995 | 3300042618 | Bacteria | 2831 |
| 112 | Ga0466705_278583 | 3300042612 | Bacteria | 19732 |
| 113 | Ga0466692_142303 | 3300042591 | Bacteria | 11124 |
| 114 | Ga0466703_142608 | 3300042636 | Bacteria | 3498 |
| 115 | Ga0466703_389486 | 3300042636 | Bacteria | 5771 |
| 116 | Ga0466713_139080 | 3300042602 | Bacteria | 2141 |
| 117 | Ga0466713_155128 | 3300042602 | Bacteria | 4770 |
| 118 | Ga0466716_401828 | 3300042605 | Bacteria | 4088 |
| 119 | Ga0123356_10038918 | 3300010049 | Bacteria | 4431 |
| 120 | Ga0123353_10229668 | 3300010167 | Unclassified | 2894 |
| 121 | JGI24702J35022_10008569 | 3300002462 | Bacteria | 5786 |
| 122 | JGI24702J35022_10098944 | 3300002462 | Unclassified | 1595 |
| 123 | Ga0466715_151762 | 3300042616 | Bacteria | 3926 |
| 124 | Ga0466715_349008 | 3300042616 | Bacteria | 9436 |
| 125 | Ga0466726_017488 | 3300042619 | Bacteria | 13070 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.