Protein Family IF08174
Metagenome
Isolate
136
Members
38
Samples
124
Scaffolds
166.99
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_342811|Ga0466723_342811_6873_7442
- Length
- 189 aa
- Sequence
- MDVFVKMDTKYINYKLKKIIVMSKIGIFYGSSGGNTQEVAKRIAKKLGVNDKDIYDVGKAKASDLTCCEKLLFGTSTWGLGDLQDDWEGFIDNVAAADLSGKKVALFGCGDSSSYSDTFCDAMGKIYRRIKDKTTVVGFTSTEGYSFDASEAVIDKRFVGLAIDEENESNLTDKRIDGWVTQLKKELEL
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Rhinotermitidae
13.2%
Unclassified
13.2%
Blattidae
13.2%
Termopsidae
10.5%
Hydrophilidae
5.3%
Termitidae
2.6%
Tenebrionidae
2.6%
Passalidae
2.6%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 24 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 27 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 28 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 29 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 30 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_183272 | 3300042659 | Bacteria | 2007 |
| 2 | Ga0466733_190486 | 3300042659 | Bacteria | 10295 |
| 3 | Ga0068302_10134429 | 3300005071 | Bacteria | 768 |
| 4 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 5 | Ga0466715_114091 | 3300042616 | Bacteria | 11441 |
| 6 | Ga0466723_086394 | 3300042618 | Bacteria | 34576 |
| 7 | Ga0466726_090534 | 3300042619 | Bacteria | 4531 |
| 8 | Ga0466726_199533 | 3300042619 | Bacteria | 3170 |
| 9 | Ga0466709_126797 | 3300042648 | Bacteria | 12218 |
| 10 | Ga0466692_137050 | 3300042591 | Bacteria | 50701 |
| 11 | Ga0466692_190832 | 3300042591 | Bacteria | 7445 |
| 12 | Ga0068302_10131710 | 3300005071 | Bacteria | 1305 |
| 13 | Ga0466713_005635 | 3300042602 | Bacteria | 57913 |
| 14 | Ga0466722_224406 | 3300042609 | Bacteria | 14744 |
| 15 | Ga0466711_106704 | 3300042615 | Bacteria | 17120 |
| 16 | Ga0466711_142023 | 3300042615 | Bacteria | 20636 |
| 17 | Ga0466726_016925 | 3300042619 | Bacteria | 2690 |
| 18 | Ga0466726_082359 | 3300042619 | Bacteria | 1307 |
| 19 | Ga0466705_333989 | 3300042612 | Bacteria | 2549 |
| 20 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 21 | Ga0466690_301695 | 3300042590 | Bacteria | 5907 |
| 22 | Ga0466692_127794 | 3300042591 | Bacteria | 5623 |
| 23 | Ga0466696_024346 | 3300042596 | Bacteria | 7359 |
| 24 | Ga0466719_007793 | 3300042606 | Bacteria | 1651 |
| 25 | Ga0466719_325701 | 3300042606 | Bacteria | 2537 |
| 26 | Ga0466719_423843 | 3300042606 | Bacteria | 1290 |
| 27 | Ga0466722_147115 | 3300042609 | Bacteria | 7062 |
| 28 | Ga0466723_101863 | 3300042618 | Bacteria | 35831 |
| 29 | Ga0466723_170719 | 3300042618 | Bacteria | 19996 |
| 30 | Ga0466728_000623 | 3300042620 | Bacteria | 4961 |
| 31 | Ga0466703_179101 | 3300042636 | Bacteria | 5372 |
| 32 | Ga0466733_176526 | 3300042659 | Bacteria | 102706 |
| 33 | Ga0466690_037529 | 3300042590 | Bacteria | 3589 |
| 34 | Ga0466692_131114 | 3300042591 | Bacteria | 2105 |
| 35 | Ga0466692_191596 | 3300042591 | Bacteria | 3424 |
| 36 | Ga0466691_053507 | 3300042593 | Bacteria | 8560 |
| 37 | Ga0466696_100909 | 3300042596 | Bacteria | 4307 |
| 38 | Ga0466707_091247 | 3300042601 | Bacteria | 5332 |
| 39 | Ga0466713_025311 | 3300042602 | Unclassified | 1347 |
| 40 | Ga0466719_211075 | 3300042606 | Bacteria | 1407 |
| 41 | Ga0466722_007149 | 3300042609 | Bacteria | 1058 |
| 42 | Ga0466722_085061 | 3300042609 | Bacteria | 2343 |
| 43 | Ga0466722_127247 | 3300042609 | Bacteria | 26149 |
| 44 | Ga0466722_130920 | 3300042609 | Bacteria | 11261 |
| 45 | Ga0466711_054535 | 3300042615 | Bacteria | 2908 |
| 46 | Ga0466711_424626 | 3300042615 | Bacteria | 30930 |
| 47 | Ga0466715_182396 | 3300042616 | Bacteria | 25679 |
| 48 | Ga0466715_201379 | 3300042616 | Unclassified | 3572 |
| 49 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 50 | Ga0466726_072057 | 3300042619 | Bacteria | 16625 |
| 51 | Ga0466728_113774 | 3300042620 | Bacteria | 2663 |
| 52 | Ga0466729_123955 | 3300042621 | Bacteria | 1149 |
| 53 | Ga0466703_134508 | 3300042636 | Bacteria | 9884 |
| 54 | Ga0466704_309581 | 3300042643 | Bacteria | 1232 |
| 55 | Ga0466708_016107 | 3300042652 | Bacteria | 19240 |
| 56 | Ga0466727_063790 | 3300042655 | Unclassified | 1000 |
| 57 | Ga0466705_195671 | 3300042612 | Bacteria | 4284 |
| 58 | Ga0466733_016756 | 3300042659 | Bacteria | 85281 |
| 59 | Ga0466696_054920 | 3300042596 | Bacteria | 2327 |
| 60 | Ga0466696_173519 | 3300042596 | Bacteria | 3367 |
| 61 | Ga0466716_204215 | 3300042605 | Bacteria | 10305 |
| 62 | Ga0466719_414001 | 3300042606 | Bacteria | 10501 |
| 63 | Ga0466722_044654 | 3300042609 | Bacteria | 21236 |
| 64 | Ga0466722_070278 | 3300042609 | Bacteria | 1002 |
| 65 | Ga0466722_163621 | 3300042609 | Bacteria | 7200 |
| 66 | Ga0466722_166939 | 3300042609 | Bacteria | 2081 |
| 67 | Ga0466715_011076 | 3300042616 | Bacteria | 39815 |
| 68 | Ga0466715_579468 | 3300042616 | Bacteria | 8652 |
| 69 | Ga0466723_135068 | 3300042618 | Bacteria | 6541 |
| 70 | Ga0466723_342811 | 3300042618 | Bacteria | 25080 |
| 71 | Ga0466735_002727 | 3300042624 | Bacteria | 8571 |
| 72 | Ga0466703_084367 | 3300042636 | Bacteria | 1548 |
| 73 | Ga0466727_048091 | 3300042655 | Bacteria | 3934 |
| 74 | Ga0466733_094906 | 3300042659 | Unclassified | 3781 |
| 75 | Ga0466733_149044 | 3300042659 | Bacteria | 119901 |
| 76 | Ga0466690_391814 | 3300042590 | Bacteria | 8130 |
| 77 | Ga0466692_011498 | 3300042591 | Bacteria | 13679 |
| 78 | Ga0466692_169709 | 3300042591 | Bacteria | 12436 |
| 79 | Ga0466691_063409 | 3300042593 | Bacteria | 6123 |
| 80 | Ga0466691_069453 | 3300042593 | Bacteria | 2182 |
| 81 | Ga0466696_031030 | 3300042596 | Bacteria | 25525 |
| 82 | IMNBL1DRAFT_c0000963 | 3300000062 | Bacteria | 22244 |
| 83 | Ga0068302_10063460 | 3300005071 | Bacteria | 1711 |
| 84 | Ga0466722_048454 | 3300042609 | Bacteria | 30141 |
| 85 | Ga0466722_171130 | 3300042609 | Bacteria | 1249 |
| 86 | Ga0466723_236750 | 3300042618 | Bacteria | 2391 |
| 87 | Ga0466726_145685 | 3300042619 | Bacteria | 2931 |
| 88 | Ga0466735_134327 | 3300042624 | Bacteria | 2383 |
| 89 | Ga0466703_339301 | 3300042636 | Bacteria | 24167 |
| 90 | Ga0466709_293592 | 3300042648 | Bacteria | 4793 |
| 91 | Ga0466709_414184 | 3300042648 | Bacteria | 28260 |
| 92 | Ga0466708_170703 | 3300042652 | Bacteria | 16219 |
| 93 | Ga0466705_038966 | 3300042612 | Bacteria | 2149 |
| 94 | Ga0466705_081467 | 3300042612 | Bacteria | 3277 |
| 95 | Ga0466705_176630 | 3300042612 | Bacteria | 10945 |
| 96 | Ga0466733_080200 | 3300042659 | Bacteria | 17486 |
| 97 | Ga0466690_018416 | 3300042590 | Bacteria | 12885 |
| 98 | Ga0466690_145008 | 3300042590 | Bacteria | 4144 |
| 99 | Ga0466690_199730 | 3300042590 | Bacteria | 8024 |
| 100 | Ga0466691_101246 | 3300042593 | Bacteria | 6446 |
| 101 | Ga0466719_149481 | 3300042606 | Unclassified | 1816 |
| 102 | Ga0466711_258664 | 3300042615 | Bacteria | 8949 |
| 103 | Ga0466704_143254 | 3300042643 | Unclassified | 2013 |
| 104 | Ga0466709_163478 | 3300042648 | Bacteria | 96467 |
| 105 | Ga0466708_144539 | 3300042652 | Bacteria | 23242 |
| 106 | Ga0466705_285623 | 3300042612 | Bacteria | 8793 |
| 107 | Ga0466705_337279 | 3300042612 | Bacteria | 3295 |
| 108 | Ga0466733_032122 | 3300042659 | Bacteria | 1861 |
| 109 | Ga0466690_124270 | 3300042590 | Bacteria | 2058 |
| 110 | Ga0466690_270316 | 3300042590 | Bacteria | 7127 |
| 111 | Ga0466691_006204 | 3300042593 | Bacteria | 41421 |
| 112 | Ga0466696_383373 | 3300042596 | Bacteria | 8113 |
| 113 | Ga0466713_014859 | 3300042602 | Bacteria | 3192 |
| 114 | Ga0466713_034599 | 3300042602 | Bacteria | 147320 |
| 115 | Ga0466719_009508 | 3300042606 | Bacteria | 1110 |
| 116 | Ga0466719_341882 | 3300042606 | Bacteria | 7592 |
| 117 | Ga0466719_356108 | 3300042606 | Bacteria | 1264 |
| 118 | Ga0466722_056315 | 3300042609 | Bacteria | 6376 |
| 119 | Ga0466715_087187 | 3300042616 | Bacteria | 23079 |
| 120 | Ga0466715_098941 | 3300042616 | Bacteria | 40534 |
| 121 | Ga0466723_108955 | 3300042618 | Bacteria | 15651 |
| 122 | Ga0466703_038917 | 3300042636 | Bacteria | 1633 |
| 123 | Ga0466704_161840 | 3300042643 | Bacteria | 7044 |
| 124 | Ga0466704_269141 | 3300042643 | Bacteria | 2864 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00258 | GO:0010181 | FMN binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.