Protein Family IF08169

Metagenome Isolate
116 Members
49 Samples
106 Scaffolds
473.43 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_332256|Ga0466723_332256_11628_13208
Length
526 aa
Sequence
LTAGAFESIIVSGFDGPKPENARKPKKNFSGSKGRGRFSMETMEPVIGLEIHAQLNTRTKLFCACPTEFGAVPNTNVCEVCTGQPGALPRMNGKALELAAKAGLALGSAVNRESLFSRKNYFYPDLPNGFQTSQLDPPICQGGSLTLELGDGTEKTVRLNRIHMEDDAGKCLHDEKRGLSLVDLNRAGTPLIEIVTEPDLSSASEAVNFLKKLHALLVRLGVTKGRMEEGEFRCDVNISLKPKGSPVLGTRAEIKNLNSFKFVGQAIEYEIERQTGVYGRGGSVSQETLHFDSEKGETRSLRSKEEAHDYRYFPQPDLPPVEISGELLARLRETLPPTPEEAKKRLVALGLKPRQAELLLERPGAPEYFHEAHKIDDDAPRIYSLMEELFLPACQKEGLDPSDSLFAPPKLAALAKLLRDGTVGRRKAQELFPDFFAKGSDPSEAVRSGNLSQITDPSELLPMVEKVAGAFEKEAKKFLSGEEKILSFLVGQVMKESRGRACPKTSAELMKNHVKERFAGAAKETV

📊 Sample Types

Isolate 8.6%
Metagenome 91.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.7%
Kalotermitidae 27.7%
Unclassified 21.3%
Termopsidae 4.3%
Porcellionidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820039837 Unclassified Saccharibacteria Emb289P1bin99 Isolate Unclassified
2 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
3 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
4 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 8073539042 Candidatus Rhabdochlamydia porcellionis 15C Isolate Porcellionidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
26 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
35 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
39 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
40 2820468515 Unclassified Firmicutes Lab288P1bin95 Isolate Unclassified
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_016848 3300042659 Bacteria 2912
2 Ga0466723_185692 3300042618 Bacteria 13967
3 Ga0466728_286164 3300042620 Bacteria 4038
4 Ga0123355_10000085 3300009826 Bacteria 98363
5 Ga0123353_10025903 3300010167 Bacteria 8944
6 Ga0466716_162151 3300042605 Bacteria 2987
7 JGI24695J34938_10009349 3300002450 Bacteria 5458
8 JGI24702J35022_10000033 3300002462 Bacteria 56870
9 JGI24702J35022_10006041 3300002462 Bacteria 7027
10 Ga0466705_398108 3300042612 Bacteria 33933
11 Ga0466712_127240 3300042614 Unclassified 2459
12 Ga0466711_343860 3300042615 Bacteria 3621
13 Ga0466715_287212 3300042616 Bacteria 8418
14 Ga0466723_006914 3300042618 Bacteria 8453
15 Ga0466723_292802 3300042618 Bacteria 5344
16 Ga0466723_332256 3300042618 Bacteria 14143
17 Ga0123353_10210696 3300010167 Bacteria 3048
18 Ga0466731_189570 3300042622 Bacteria 2518
19 Ga0466735_031528 3300042624 Bacteria 63234
20 Ga0466717_041319 3300042604 Bacteria 7641
21 Ga0466716_011417 3300042605 Bacteria 34761
22 Ga0466719_190146 3300042606 Bacteria 3859
23 Ga0466694_228989 3300042594 Bacteria 5162
24 Ga0466696_284842 3300042596 Bacteria 8370
25 JGI24698J34947_10004620 3300002449 Bacteria 7506
26 Ga0466705_100416 3300042612 Bacteria 24453
27 Ga0466705_434902 3300042612 Bacteria 16423
28 Ga0466715_582252 3300042616 Bacteria 13987
29 Ga0466723_156336 3300042618 Bacteria 66803
30 Ga0466723_186311 3300042618 Bacteria 2354
31 Ga0466728_064265 3300042620 Bacteria 29797
32 Ga0466728_112672 3300042620 Bacteria 5396
33 Ga0466709_294285 3300042648 Bacteria 5084
34 Ga0466700_028165 3300042600 Bacteria 4647
35 Ga0466716_481588 3300042605 Bacteria 12001
36 Ga0264413_142816 3300024493 Bacteria 10947
37 Ga0466693_051913 3300042592 Bacteria 4695
38 Ga0466691_061182 3300042593 Bacteria 27819
39 Ga0466691_082943 3300042593 Bacteria 3152
40 Ga0466691_114520 3300042593 Bacteria 4100
41 JGI24698J34947_10006555 3300002449 Bacteria 6391
42 JGI24698J34947_10042243 3300002449 Bacteria 2344
43 Ga0466705_013804 3300042612 Bacteria 35138
44 Ga0466715_036671 3300042616 Bacteria 13068
45 Ga0466715_622158 3300042616 Bacteria 6730
46 Ga0466718_040366 3300042617 Bacteria 5334
47 Ga0466718_065941 3300042617 Bacteria 4845
48 Ga0466723_079261 3300042618 Bacteria 5551
49 Ga0123356_10000946 3300010049 Bacteria 32088
50 Ga0466704_228491 3300042643 Bacteria 10241
51 Ga0466701_024713 3300042598 Bacteria 3208
52 Ga0466707_322892 3300042601 Bacteria 10647
53 Ga0466716_014413 3300042605 Bacteria 3576
54 Ga0466716_383185 3300042605 Bacteria 3509
55 Ga0466696_490059 3300042596 Bacteria 27849
56 JGI24695J34938_10043936 3300002450 Bacteria 1990
57 Ga0072941_1121733 3300005201 Bacteria 8774
58 Ga0466712_076789 3300042614 Unclassified 27472
59 Ga0466715_239549 3300042616 Bacteria 5861
60 Ga0466723_068352 3300042618 Bacteria 9482
61 Ga0466723_204286 3300042618 Bacteria 5217
62 Ga0466723_284341 3300042618 Bacteria 5996
63 Ga0466723_332696 3300042618 Bacteria 2122
64 Ga0123356_10002171 3300010049 Bacteria 21111
65 Ga0466735_017371 3300042624 Bacteria 2661
66 Ga0466704_309886 3300042643 Unclassified 30470
67 Ga0466716_121314 3300042605 Bacteria 1841
68 Ga0466699_441024 3300042597 Bacteria 3782
69 Ga0466705_126207 3300042612 Bacteria 16830
70 Ga0466715_236067 3300042616 Bacteria 4979
71 Ga0466715_305358 3300042616 Bacteria 9860
72 Ga0466718_050549 3300042617 Bacteria 2043
73 Ga0466704_498341 3300042643 Unclassified 6939
74 Ga0466709_301887 3300042648 Bacteria 23681
75 Ga0466708_073499 3300042652 Bacteria 29570
76 Ga0466720_043591 3300042607 Bacteria 5422
77 Ga0466721_108132 3300042608 Bacteria 11911
78 Ga0466691_130946 3300042593 Archaea 2405
79 Ga0466696_084201 3300042596 Bacteria 21942
80 JGI24698J34947_10025035 3300002449 Bacteria 3179
81 Ga0466705_359558 3300042612 Bacteria 13284
82 Ga0466732_053138 3300042656 Bacteria 9642
83 Ga0466715_053603 3300042616 Bacteria 17034
84 Ga0466715_064062 3300042616 Bacteria 11229
85 Ga0466723_041929 3300042618 Bacteria 2349
86 Ga0466723_066810 3300042618 Bacteria 19719
87 Ga0466723_181127 3300042618 Bacteria 2625
88 Ga0466723_211127 3300042618 Bacteria 29080
89 Ga0466728_065300 3300042620 Bacteria 103899
90 Ga0123356_10008286 3300010049 Bacteria 10341
91 Ga0466708_187536 3300042652 Bacteria 21535
92 Ga0466708_201828 3300042652 Bacteria 2716
93 Ga0072940_1129416 3300005200 Bacteria 3927
94 Ga0466705_040738 3300042612 Bacteria 18671
95 Ga0466705_268529 3300042612 Bacteria 91330
96 Ga0466711_081848 3300042615 Bacteria 31590
97 Ga0466718_100385 3300042617 Bacteria 4342
98 Ga0466718_159710 3300042617 Bacteria 3534
99 Ga0123355_10000769 3300009826 Bacteria 43805
100 Ga0466703_087241 3300042636 Bacteria 21848
101 Ga0466703_309188 3300042636 Bacteria 2985
102 Ga0466701_072124 3300042598 Bacteria 1854
103 Ga0466719_000915 3300042606 Bacteria 14192
104 Ga0466697_022245 3300042611 Bacteria 6117
105 Ga0264413_139977 3300024493 Bacteria 10622
106 Ga0068302_10322663 3300005071 Bacteria 2777

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_024713 Ga0466701_024713_1994_3169 391
2 3300042617 Ga0466718_159710 Ga0466718_159710_2181_3413 410
3 3300042597 Ga0466699_441024 Ga0466699_441024_2469_3740 423
4 3300042617 Ga0466718_100385 Ga0466718_100385_158_1435 425
5 3300042618 Ga0466723_068352 Ga0466723_068352_1500_2777 425
6 3300042618 Ga0466723_211127 Ga0466723_211127_14465_15745 426
7 3300042620 Ga0466728_112672 Ga0466728_112672_561_1844 427
8 3300042616 Ga0466715_064062 Ga0466715_064062_3894_5180 428
9 3300042616 Ga0466715_582252 Ga0466715_582252_5642_6931 429
10 3300009826 Ga0123355_10000085 Ga0123355_1000008580 430
11 3300042648 Ga0466709_294285 Ga0466709_294285_3725_5017 430
12 3300042606 Ga0466719_190146 Ga0466719_190146_2432_3727 431
13 3300042622 Ga0466731_189570 Ga0466731_189570_47_1378 431
14 3300042594 Ga0466694_228989 Ga0466694_228989_2177_3487 436
15 3300042598 Ga0466701_072124 Ga0466701_072124_471_1826 451
16 3300042608 Ga0466721_108132 Ga0466721_108132_6978_8450 458
17 3300042614 Ga0466712_076789 Ga0466712_076789_14446_15825 459
18 3300042616 Ga0466715_622158 Ga0466715_622158_3119_4555 460
19 3300042618 Ga0466723_156336 Ga0466723_156336_31790_33211 460
20 3300042624 Ga0466735_031528 Ga0466735_031528_31071_32498 466
21 iso_pr_bacteria 2758568796 2761047258 466
22 3300042618 Ga0466723_284341 Ga0466723_284341_2571_4013 468
23 iso_pr_bacteria 2820468515 2820469211 469
24 3300042604 Ga0466717_041319 Ga0466717_041319_2207_3625 472
25 3300042614 Ga0466712_127240 Ga0466712_127240_664_2085 473
26 3300042620 Ga0466728_286164 Ga0466728_286164_959_2380 473
27 3300024493 Ga0264413_139977 Ga0264413_1399774 474
28 3300042617 Ga0466718_065941 Ga0466718_065941_303_1727 474
29 3300042656 Ga0466732_053138 Ga0466732_053138_267_1691 474
30 3300002449 JGI24698J34947_10025035 JGI24698J34947_100250351 475
31 3300002449 JGI24698J34947_10042243 JGI24698J34947_100422431 475
32 3300002450 JGI24695J34938_10043936 JGI24695J34938_100439361 475
33 3300010167 Ga0123353_10210696 Ga0123353_102106963 475
34 3300024493 Ga0264413_142816 Ga0264413_1428169 475
35 3300042618 Ga0466723_066810 Ga0466723_066810_10923_12350 475
36 3300042593 Ga0466691_082943 Ga0466691_082943_347_1822 476
37 3300042600 Ga0466700_028165 Ga0466700_028165_112_1542 476
38 3300042601 Ga0466707_322892 Ga0466707_322892_3144_4574 476
39 3300042612 Ga0466705_359558 Ga0466705_359558_10270_11700 476
40 3300042636 Ga0466703_309188 Ga0466703_309188_1185_2615 476
41 iso_pr_bacteria 2820053807 2820055310 476
42 iso_pr_bacteria 2820134530 2820136328 476
43 3300010049 Ga0123356_10008286 Ga0123356_100082863 477
44 3300042612 Ga0466705_013804 Ga0466705_013804_16502_17935 477
45 3300042612 Ga0466705_126207 Ga0466705_126207_11631_13064 477
46 3300042643 Ga0466704_309886 Ga0466704_309886_14860_16293 477
47 iso_pr_bacteria 2820166269 2820167841 477
48 iso_pr_bacteria 2820168331 2820169846 477
49 iso_pr_bacteria 2820170025 2820170558 477
50 3300002450 JGI24695J34938_10009349 JGI24695J34938_100093492 478
51 3300010167 Ga0123353_10025903 Ga0123353_100259037 478
52 3300042605 Ga0466716_014413 Ga0466716_014413_1924_3360 478
53 3300042605 Ga0466716_383185 Ga0466716_383185_1371_2807 478
54 3300042615 Ga0466711_343860 Ga0466711_343860_1900_3336 478
55 3300042616 Ga0466715_239549 Ga0466715_239549_1319_2755 478
56 3300042616 Ga0466715_287212 Ga0466715_287212_4142_5578 478
57 3300042618 Ga0466723_006914 Ga0466723_006914_4458_5894 478
58 3300042618 Ga0466723_185692 Ga0466723_185692_11428_12864 478
59 3300042624 Ga0466735_017371 Ga0466735_017371_495_1931 478
60 3300010049 Ga0123356_10002171 Ga0123356_100021712 479
61 3300042593 Ga0466691_130946 Ga0466691_130946_868_2307 479
62 3300042605 Ga0466716_162151 Ga0466716_162151_1261_2700 479
63 3300042618 Ga0466723_041929 Ga0466723_041929_634_2073 479
64 3300042618 Ga0466723_079261 Ga0466723_079261_3928_5367 479
65 3300042618 Ga0466723_186311 Ga0466723_186311_319_1758 479
66 3300005071 Ga0068302_10322663 Ga0068302_103226633 480
67 3300042596 Ga0466696_284842 Ga0466696_284842_1488_2930 480
68 3300042605 Ga0466716_121314 Ga0466716_121314_317_1759 480
69 3300042606 Ga0466719_000915 Ga0466719_000915_8686_10128 480
70 3300042612 Ga0466705_100416 Ga0466705_100416_9889_11331 480
71 3300042612 Ga0466705_398108 Ga0466705_398108_6051_7493 480
72 3300042615 Ga0466711_081848 Ga0466711_081848_1965_3407 480
73 3300042616 Ga0466715_053603 Ga0466715_053603_40_1482 480
74 3300042616 Ga0466715_236067 Ga0466715_236067_2524_3966 480
75 3300042618 Ga0466723_332696 Ga0466723_332696_636_2078 480
76 3300042652 Ga0466708_201828 Ga0466708_201828_13_1455 480
77 3300042617 Ga0466718_040366 Ga0466718_040366_1800_3245 481
78 3300042618 Ga0466723_204286 Ga0466723_204286_608_2053 481
79 3300002449 JGI24698J34947_10004620 JGI24698J34947_100046201 482
80 3300002449 JGI24698J34947_10006555 JGI24698J34947_100065555 482
81 3300005200 Ga0072940_1129416 Ga0072940_11294165 482
82 3300042607 Ga0466720_043591 Ga0466720_043591_3609_5057 482
83 3300042611 Ga0466697_022245 Ga0466697_022245_983_2431 482
84 3300042616 Ga0466715_036671 Ga0466715_036671_7836_9284 482
85 3300042618 Ga0466723_292802 Ga0466723_292802_3020_4468 482
86 3300042636 Ga0466703_087241 Ga0466703_087241_16375_17862 482
87 3300002462 JGI24702J35022_10006041 JGI24702J35022_100060414 483
88 3300042652 Ga0466708_187536 Ga0466708_187536_4309_5760 483
89 iso_pr_bacteria 2820039837 2820040523 483
90 3300005201 Ga0072941_1121733 Ga0072941_11217334 484
91 3300009826 Ga0123355_10000769 Ga0123355_1000076914 484
92 3300042593 Ga0466691_114520 Ga0466691_114520_2346_3800 484
93 3300042612 Ga0466705_268529 Ga0466705_268529_20122_21576 484
94 3300042617 Ga0466718_050549 Ga0466718_050549_18_1472 484
95 3300042643 Ga0466704_228491 Ga0466704_228491_7977_9431 484
96 3300042643 Ga0466704_498341 Ga0466704_498341_4602_6056 484
97 3300042652 Ga0466708_073499 Ga0466708_073499_15148_16608 486
98 3300042620 Ga0466728_064265 Ga0466728_064265_14623_16107 487
99 3300042593 Ga0466691_061182 Ga0466691_061182_7252_8751 488
100 3300042596 Ga0466696_084201 Ga0466696_084201_12509_13978 489
101 3300042605 Ga0466716_011417 Ga0466716_011417_17022_18491 489
102 3300042612 Ga0466705_040738 Ga0466705_040738_8312_9781 489
103 3300042612 Ga0466705_434902 Ga0466705_434902_7794_9263 489
104 3300042659 Ga0466733_016848 Ga0466733_016848_306_1775 489
105 iso_pr_bacteria 2820729191 2820729201 489
106 iso_pr_bacteria 8073539042 8073539846 489
107 3300002462 JGI24702J35022_10000033 JGI24702J35022_1000003311 490
108 3300010049 Ga0123356_10000946 Ga0123356_1000094623 490
109 3300042605 Ga0466716_481588 Ga0466716_481588_2110_3582 490
110 3300042618 Ga0466723_181127 Ga0466723_181127_57_1532 491
111 3300042620 Ga0466728_065300 Ga0466728_065300_73894_75369 491
112 3300042648 Ga0466709_301887 Ga0466709_301887_14853_16328 491
113 3300042616 Ga0466715_305358 Ga0466715_305358_3377_4864 495
114 3300042592 Ga0466693_051913 Ga0466693_051913_645_2159 504
115 3300042596 Ga0466696_490059 Ga0466696_490059_13886_15439 517
116 3300042618 Ga0466723_332256 Ga0466723_332256_11628_13208 526

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02934 GatB_N GatB/GatE catalytic domain 46 328 0.99
PF02637 GatB_Yqey GatB domain 367 512 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02934 GO:0016874 ligase activity MF
PF02637 GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.