Protein Family IF08166
Metagenome
Isolate
129
Members
45
Samples
125
Scaffolds
326.95
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_329121|Ga0466723_329121_3749_4918
- Length
- 389 aa
- Sequence
- MSIPFLLAPMAEISHRALRELIESFGNGAAEYYTEMISAGALVGGGPFEKWYTDPGPCPQKLVYQLVGADREQLAKAASLLDKLECNDPRTGEGGCLGIDINMGCAAPAITRTGAGVRWMEDMDKAGGMIALVRKQVKRRLSVKLRLGFVSRGGSEEAAFGYLVRFCRRLEAEGVELITLHPRTAKEKFRRSARWEYVSALRRELGIPVAGNGGIMSAKEMLAKSADCDAVMIGRLAVTKPWIFAQAHALEQNGKLAPDNGQSTNPAEWTGYGPACESTAAQADGVWTLCNEPEKPHPAPGFPAPPCLEKIGLNFLELLARYQPPEFRLSRARRFFNCFCDNLTWGNHVKNLLNREKSLGEIERVWKDYFAANPEENKTLEALVNSIEN
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.5%
Kalotermitidae
27.9%
Unclassified
11.6%
Termopsidae
7.0%
Rhinotermitidae
4.7%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 9 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 10 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 22 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10060642 | 3300010167 | Bacteria | 6066 |
| 2 | Ga0466720_046265 | 3300042607 | Bacteria | 10532 |
| 3 | Ga0466720_154320 | 3300042607 | Bacteria | 1495 |
| 4 | Ga0466722_000469 | 3300042609 | Bacteria | 4191 |
| 5 | Ga0466712_124041 | 3300042614 | Bacteria | 18962 |
| 6 | Ga0466718_026054 | 3300042617 | Bacteria | 12053 |
| 7 | Ga0466723_195871 | 3300042618 | Bacteria | 20538 |
| 8 | Ga0466723_340850 | 3300042618 | Bacteria | 7615 |
| 9 | Ga0466728_037216 | 3300042620 | Bacteria | 9530 |
| 10 | Ga0466728_144348 | 3300042620 | Bacteria | 12365 |
| 11 | Ga0466703_091206 | 3300042636 | Bacteria | 37744 |
| 12 | Ga0072941_1073501 | 3300005201 | Bacteria | 5723 |
| 13 | Ga0466694_083444 | 3300042594 | Bacteria | 6986 |
| 14 | Ga0466699_345647 | 3300042597 | Bacteria | 2205 |
| 15 | Ga0123356_10000059 | 3300010049 | Bacteria | 117133 |
| 16 | Ga0123353_10109080 | 3300010167 | Bacteria | 4460 |
| 17 | Ga0466720_024952 | 3300042607 | Bacteria | 12599 |
| 18 | Ga0466711_119937 | 3300042615 | Bacteria | 22651 |
| 19 | Ga0466711_143272 | 3300042615 | Bacteria | 2298 |
| 20 | Ga0466715_195209 | 3300042616 | Bacteria | 10518 |
| 21 | Ga0466715_288599 | 3300042616 | Bacteria | 3823 |
| 22 | Ga0466723_329121 | 3300042618 | Bacteria | 11043 |
| 23 | Ga0466726_286903 | 3300042619 | Bacteria | 1397 |
| 24 | Ga0466735_074936 | 3300042624 | Bacteria | 1740 |
| 25 | Ga0466704_170173 | 3300042643 | Bacteria | 13167 |
| 26 | Ga0466709_063776 | 3300042648 | Bacteria | 6904 |
| 27 | JGI24698J34947_10032823 | 3300002449 | Bacteria | 2724 |
| 28 | JGI24698J34947_10065414 | 3300002449 | Bacteria | 1773 |
| 29 | Ga0072941_1119427 | 3300005201 | Bacteria | 2745 |
| 30 | Ga0123357_10000140 | 3300009784 | Bacteria | 63300 |
| 31 | Ga0466694_245438 | 3300042594 | Bacteria | 3328 |
| 32 | Ga0466696_216914 | 3300042596 | Bacteria | 9997 |
| 33 | Ga0466699_042022 | 3300042597 | Bacteria | 4178 |
| 34 | Ga0466699_214625 | 3300042597 | Bacteria | 21334 |
| 35 | Ga0466699_312204 | 3300042597 | Bacteria | 1776 |
| 36 | Ga0466705_016047 | 3300042612 | Bacteria | 3580 |
| 37 | Ga0466732_077440 | 3300042656 | Bacteria | 3966 |
| 38 | Ga0123353_11176694 | 3300010167 | Bacteria | 1009 |
| 39 | Ga0466720_012183 | 3300042607 | Bacteria | 3105 |
| 40 | Ga0466711_195788 | 3300042615 | Bacteria | 43179 |
| 41 | Ga0466718_105174 | 3300042617 | Bacteria | 2043 |
| 42 | Ga0466723_372532 | 3300042618 | Bacteria | 4311 |
| 43 | Ga0466735_120167 | 3300042624 | Unclassified | 8916 |
| 44 | JGI24698J34947_10035961 | 3300002449 | Bacteria | 2581 |
| 45 | JGI24700J35501_10930476 | 3300002508 | Bacteria | 14577 |
| 46 | Ga0264413_115075 | 3300024493 | Bacteria | 4918 |
| 47 | Ga0123354_10012082 | 3300010882 | Bacteria | 13367 |
| 48 | Ga0466720_085663 | 3300042607 | Bacteria | 7945 |
| 49 | Ga0466712_188876 | 3300042614 | Bacteria | 23335 |
| 50 | Ga0466712_260420 | 3300042614 | Bacteria | 19474 |
| 51 | Ga0466728_141462 | 3300042620 | Bacteria | 6258 |
| 52 | Ga0466728_418874 | 3300042620 | Bacteria | 25820 |
| 53 | Ga0466735_086455 | 3300042624 | Bacteria | 7149 |
| 54 | Ga0466703_205060 | 3300042636 | Bacteria | 3931 |
| 55 | AustNasuHG_c1002303 | 3300000089 | Bacteria | 6890 |
| 56 | JGI24698J34947_10073758 | 3300002449 | Bacteria | 1627 |
| 57 | JGI24698J34947_10109661 | 3300002449 | Bacteria | 1221 |
| 58 | Ga0072941_1046087 | 3300005201 | Bacteria | 2846 |
| 59 | Ga0264413_115076 | 3300024493 | Bacteria | 3007 |
| 60 | Ga0466694_146023 | 3300042594 | Bacteria | 7613 |
| 61 | Ga0466732_063514 | 3300042656 | Bacteria | 1455 |
| 62 | Ga0466732_091197 | 3300042656 | Bacteria | 3577 |
| 63 | Ga0466712_034210 | 3300042614 | Bacteria | 1458 |
| 64 | Ga0466711_010434 | 3300042615 | Bacteria | 6246 |
| 65 | Ga0466729_248553 | 3300042621 | Bacteria | 1857 |
| 66 | Ga0466727_095687 | 3300042655 | Bacteria | 8107 |
| 67 | JGI24699J35502_11052007 | 3300002509 | Bacteria | 1660 |
| 68 | Ga0072941_1019234 | 3300005201 | Bacteria | 13089 |
| 69 | Ga0264413_119457 | 3300024493 | Bacteria | 12229 |
| 70 | Ga0415639_001709 | 3300038395 | Bacteria | 19835 |
| 71 | Ga0466694_099814 | 3300042594 | Bacteria | 1947 |
| 72 | Ga0466732_013058 | 3300042656 | Bacteria | 11491 |
| 73 | Ga0123353_10126154 | 3300010167 | Bacteria | 4113 |
| 74 | Ga0466706_260476 | 3300042599 | Bacteria | 1527 |
| 75 | Ga0466707_022031 | 3300042601 | Bacteria | 1516 |
| 76 | Ga0466719_357893 | 3300042606 | Bacteria | 2602 |
| 77 | Ga0466720_005069 | 3300042607 | Bacteria | 9617 |
| 78 | Ga0466720_008269 | 3300042607 | Bacteria | 14083 |
| 79 | Ga0466712_002993 | 3300042614 | Bacteria | 4610 |
| 80 | Ga0466712_064553 | 3300042614 | Bacteria | 17182 |
| 81 | Ga0466718_044351 | 3300042617 | Unclassified | 7174 |
| 82 | Ga0466726_206818 | 3300042619 | Bacteria | 1188 |
| 83 | Ga0466726_231713 | 3300042619 | Bacteria | 6017 |
| 84 | AustNasuHG_c1000642 | 3300000089 | Bacteria | 12343 |
| 85 | AustNasuHG_c1005934 | 3300000089 | Bacteria | 4367 |
| 86 | JGI24698J34947_10006021 | 3300002449 | Bacteria | 6659 |
| 87 | JGI24698J34947_10050310 | 3300002449 | Bacteria | 2103 |
| 88 | Ga0072940_1034741 | 3300005200 | Bacteria | 2242 |
| 89 | Ga0072941_1000915 | 3300005201 | Bacteria | 20868 |
| 90 | Ga0072941_1059139 | 3300005201 | Bacteria | 3910 |
| 91 | Ga0415639_002790 | 3300038395 | Bacteria | 1264 |
| 92 | Ga0466690_145052 | 3300042590 | Bacteria | 4295 |
| 93 | Ga0466699_077308 | 3300042597 | Bacteria | 23688 |
| 94 | Ga0466705_100998 | 3300042612 | Bacteria | 6114 |
| 95 | Ga0466720_050818 | 3300042607 | Bacteria | 9369 |
| 96 | Ga0466720_058071 | 3300042607 | Bacteria | 29909 |
| 97 | Ga0466715_242198 | 3300042616 | Bacteria | 5323 |
| 98 | Ga0466718_089511 | 3300042617 | Bacteria | 5375 |
| 99 | Ga0466735_218783 | 3300042624 | Bacteria | 1336 |
| 100 | Ga0466727_111701 | 3300042655 | Bacteria | 1135 |
| 101 | JGI24698J34947_10004411 | 3300002449 | Bacteria | 7662 |
| 102 | Ga0072940_1031960 | 3300005200 | Bacteria | 9067 |
| 103 | Ga0264413_127367 | 3300024493 | Bacteria | 1208 |
| 104 | Ga0466693_084313 | 3300042592 | Bacteria | 21473 |
| 105 | Ga0466696_076320 | 3300042596 | Bacteria | 10432 |
| 106 | Ga0466699_069194 | 3300042597 | Bacteria | 4915 |
| 107 | Ga0466699_326597 | 3300042597 | Bacteria | 2471 |
| 108 | Ga0123356_10023667 | 3300010049 | Bacteria | 5778 |
| 109 | Ga0466707_167682 | 3300042601 | Bacteria | 13743 |
| 110 | Ga0466720_114444 | 3300042607 | Bacteria | 17733 |
| 111 | Ga0466722_019048 | 3300042609 | Bacteria | 3053 |
| 112 | Ga0466712_177021 | 3300042614 | Bacteria | 1381 |
| 113 | Ga0466712_226351 | 3300042614 | Unclassified | 1780 |
| 114 | Ga0466718_073358 | 3300042617 | Bacteria | 27999 |
| 115 | Ga0466731_196768 | 3300042622 | Bacteria | 2163 |
| 116 | Ga0466735_156920 | 3300042624 | Bacteria | 2527 |
| 117 | Ga0466708_273325 | 3300042652 | Bacteria | 30455 |
| 118 | Ga0466727_311354 | 3300042655 | Bacteria | 2397 |
| 119 | JGI24698J34947_10025589 | 3300002449 | Bacteria | 3141 |
| 120 | JGI24698J34947_10027609 | 3300002449 | Bacteria | 3011 |
| 121 | JGI24695J34938_10000419 | 3300002450 | Bacteria | 41287 |
| 122 | Ga0072941_1011759 | 3300005201 | Bacteria | 16412 |
| 123 | Ga0264413_121691 | 3300024493 | Bacteria | 2755 |
| 124 | Ga0466690_126576 | 3300042590 | Bacteria | 9739 |
| 125 | Ga0466695_068957 | 3300042595 | Bacteria | 62949 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01207 | Dus | Dihydrouridine synthase (Dus) | 6 | 253 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.