Protein Family IF08148
Metagenome
Isolate
111
Members
35
Samples
106
Scaffolds
427.27
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_283488|Ga0466723_283488_793_2289
- Length
- 498 aa
- Sequence
- MYLIEKRVAFKRQTDMRIHKAFTLPFPFLKALRPGKMFWEIQFSVCLLSILVWRFTLKSSLTFLVLAVFITFPRFSPVLHADAPNAPVSDAAPADRDRYVFKLAVIGPGDELYFWWGHIGLIIIDTMTGAERFYDWGIFSFERENFFVNFAFGRLIYSCGASPAEKNIHFYIFTNRDITLYTLDIPPEKKDEIRRFAEWNILSENRDYYYHHFKDNCATRIRDILDAATDGRFKEAFGEAPGRFTLREHVRRHTWFSPFFDWLLNFLMGQDIDTPIKVWEEMFLPSEIALRIADFRYTDNAGRQRNLVSAVEILNRSRGRPAVLDKPRRQWPAELALGAGILGILAAFMLVKQKKTALGRMLLGISQSCLGLFFGLAGSILFFMTFFTDHDYTWHNSNILFINPLILAIVPLGIMSFREKDRKKRYKREIILKSLWTYIVIGGMLSLLIRVFPQFYQQNQVTAALVLPFALGLSFAPNWLAPIFKALCGKNETEKAQP
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
41.2%
Termitidae
23.5%
Unclassified
14.7%
Termopsidae
8.8%
Rhinotermitidae
8.8%
Blaberidae
2.9%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 2 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 20 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 21 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_063967 | 3300042659 | Bacteria | 1986 |
| 2 | Ga0466719_030202 | 3300042606 | Bacteria | 13177 |
| 3 | Ga0466719_063445 | 3300042606 | Bacteria | 5648 |
| 4 | Ga0466722_005099 | 3300042609 | Bacteria | 5010 |
| 5 | Ga0466691_165988 | 3300042593 | Bacteria | 9399 |
| 6 | Ga0466715_624959 | 3300042616 | Bacteria | 2601 |
| 7 | Ga0466723_024858 | 3300042618 | Bacteria | 9148 |
| 8 | Ga0466723_120124 | 3300042618 | Bacteria | 2308 |
| 9 | Ga0466705_137007 | 3300042612 | Bacteria | 17139 |
| 10 | Ga0466703_365875 | 3300042636 | Bacteria | 2990 |
| 11 | Ga0466709_181293 | 3300042648 | Bacteria | 9902 |
| 12 | Ga0466708_018040 | 3300042652 | Bacteria | 25323 |
| 13 | Ga0466716_103555 | 3300042605 | Bacteria | 28428 |
| 14 | Ga0466719_375065 | 3300042606 | Bacteria | 1957 |
| 15 | Ga0466690_028407 | 3300042590 | Bacteria | 8409 |
| 16 | Ga0466690_271370 | 3300042590 | Bacteria | 4493 |
| 17 | Ga0466691_068835 | 3300042593 | Bacteria | 7845 |
| 18 | Ga0466696_021850 | 3300042596 | Bacteria | 7491 |
| 19 | Ga0466696_259191 | 3300042596 | Bacteria | 12172 |
| 20 | Ga0466728_111584 | 3300042620 | Bacteria | 8063 |
| 21 | Ga0466705_234834 | 3300042612 | Bacteria | 3045 |
| 22 | Ga0466735_211852 | 3300042624 | Bacteria | 3201 |
| 23 | Ga0466702_155412 | 3300042635 | Bacteria | 2176 |
| 24 | Ga0466703_045203 | 3300042636 | Bacteria | 12054 |
| 25 | Ga0466703_049399 | 3300042636 | Bacteria | 26515 |
| 26 | Ga0466704_580451 | 3300042643 | Bacteria | 3781 |
| 27 | Ga0466708_034583 | 3300042652 | Bacteria | 20319 |
| 28 | JGI24695J34938_10010043 | 3300002450 | Bacteria | 5219 |
| 29 | JGI24695J34938_10062978 | 3300002450 | Bacteria | 1573 |
| 30 | Ga0072941_1029981 | 3300005201 | Bacteria | 5222 |
| 31 | Ga0466707_346320 | 3300042601 | Bacteria | 2909 |
| 32 | Ga0466692_108986 | 3300042591 | Bacteria | 17489 |
| 33 | Ga0466691_060866 | 3300042593 | Bacteria | 10277 |
| 34 | Ga0466705_423632 | 3300042612 | Bacteria | 2887 |
| 35 | Ga0466712_091946 | 3300042614 | Bacteria | 86490 |
| 36 | Ga0466705_152743 | 3300042612 | Bacteria | 9168 |
| 37 | Ga0466735_096865 | 3300042624 | Bacteria | 1593 |
| 38 | Ga0466704_253365 | 3300042643 | Bacteria | 2270 |
| 39 | Ga0466727_260464 | 3300042655 | Bacteria | 2708 |
| 40 | Ga0466719_006605 | 3300042606 | Bacteria | 16507 |
| 41 | Ga0466722_261779 | 3300042609 | Bacteria | 3225 |
| 42 | Ga0456237_0002487 | 3300041968 | Unclassified | 2979 |
| 43 | Ga0466690_002751 | 3300042590 | Bacteria | 16420 |
| 44 | Ga0466711_120658 | 3300042615 | Bacteria | 6249 |
| 45 | Ga0466723_022384 | 3300042618 | Bacteria | 3876 |
| 46 | Ga0466723_283488 | 3300042618 | Bacteria | 5189 |
| 47 | Ga0466728_002848 | 3300042620 | Bacteria | 8900 |
| 48 | Ga0466705_193172 | 3300042612 | Bacteria | 4526 |
| 49 | Ga0466703_106697 | 3300042636 | Bacteria | 53394 |
| 50 | Ga0466703_152916 | 3300042636 | Bacteria | 1629 |
| 51 | Ga0466704_148381 | 3300042643 | Bacteria | 10898 |
| 52 | Ga0466704_180612 | 3300042643 | Bacteria | 11675 |
| 53 | Ga0466727_078130 | 3300042655 | Bacteria | 4271 |
| 54 | Ga0466707_351646 | 3300042601 | Bacteria | 1886 |
| 55 | Ga0466719_013281 | 3300042606 | Bacteria | 28183 |
| 56 | Ga0466722_210696 | 3300042609 | Bacteria | 6288 |
| 57 | Ga0466690_087975 | 3300042590 | Bacteria | 6620 |
| 58 | Ga0466691_130566 | 3300042593 | Bacteria | 4161 |
| 59 | Ga0466696_352291 | 3300042596 | Unclassified | 3510 |
| 60 | Ga0466705_041607 | 3300042612 | Bacteria | 1670 |
| 61 | Ga0466705_308479 | 3300042612 | Bacteria | 3194 |
| 62 | Ga0466704_160887 | 3300042643 | Bacteria | 35133 |
| 63 | Ga0466704_192278 | 3300042643 | Bacteria | 6015 |
| 64 | JGI24695J34938_10000135 | 3300002450 | Bacteria | 66811 |
| 65 | Ga0466719_260373 | 3300042606 | Bacteria | 26617 |
| 66 | Ga0466722_027700 | 3300042609 | Bacteria | 4181 |
| 67 | Ga0466723_030403 | 3300042618 | Bacteria | 8098 |
| 68 | Ga0466726_303720 | 3300042619 | Bacteria | 3269 |
| 69 | Ga0466735_165476 | 3300042624 | Bacteria | 2270 |
| 70 | Ga0466703_068447 | 3300042636 | Bacteria | 14868 |
| 71 | Ga0466703_093610 | 3300042636 | Bacteria | 45768 |
| 72 | Ga0466703_137155 | 3300042636 | Bacteria | 4744 |
| 73 | Ga0466708_242556 | 3300042652 | Bacteria | 3060 |
| 74 | Ga0466722_228880 | 3300042609 | Bacteria | 4479 |
| 75 | Ga0466690_003361 | 3300042590 | Bacteria | 10331 |
| 76 | Ga0466690_146640 | 3300042590 | Bacteria | 6859 |
| 77 | Ga0466692_163657 | 3300042591 | Bacteria | 2465 |
| 78 | Ga0466693_366681 | 3300042592 | Bacteria | 24175 |
| 79 | Ga0466691_056318 | 3300042593 | Bacteria | 1575 |
| 80 | Ga0466691_154112 | 3300042593 | Bacteria | 40426 |
| 81 | Ga0466696_106864 | 3300042596 | Bacteria | 17271 |
| 82 | Ga0466696_347560 | 3300042596 | Bacteria | 1974 |
| 83 | Ga0466699_286460 | 3300042597 | Bacteria | 3071 |
| 84 | Ga0466712_044922 | 3300042614 | Bacteria | 4337 |
| 85 | Ga0466711_453752 | 3300042615 | Bacteria | 12946 |
| 86 | Ga0466723_251550 | 3300042618 | Bacteria | 26799 |
| 87 | Ga0466723_343978 | 3300042618 | Bacteria | 2497 |
| 88 | Ga0466726_043542 | 3300042619 | Bacteria | 4013 |
| 89 | Ga0466728_339355 | 3300042620 | Bacteria | 8327 |
| 90 | JGI24695J34938_10042074 | 3300002450 | Bacteria | 2047 |
| 91 | Ga0466707_129157 | 3300042601 | Bacteria | 5626 |
| 92 | Ga0466714_123459 | 3300042603 | Bacteria | 3056 |
| 93 | Ga0466716_238019 | 3300042605 | Unclassified | 2333 |
| 94 | Ga0466719_047734 | 3300042606 | Bacteria | 7681 |
| 95 | Ga0456237_0000190 | 3300041968 | Bacteria | 8999 |
| 96 | Ga0466691_034073 | 3300042593 | Bacteria | 13982 |
| 97 | Ga0466691_223822 | 3300042593 | Bacteria | 5759 |
| 98 | Ga0466694_005555 | 3300042594 | Bacteria | 2076 |
| 99 | Ga0466711_356289 | 3300042615 | Bacteria | 7305 |
| 100 | Ga0466715_232966 | 3300042616 | Bacteria | 3044 |
| 101 | Ga0466723_016587 | 3300042618 | Bacteria | 6289 |
| 102 | Ga0466723_021746 | 3300042618 | Bacteria | 41971 |
| 103 | Ga0466726_392187 | 3300042619 | Bacteria | 30982 |
| 104 | Ga0466728_230846 | 3300042620 | Bacteria | 44677 |
| 105 | Ga0466709_020555 | 3300042648 | Unclassified | 3447 |
| 106 | Ga0466708_308889 | 3300042652 | Bacteria | 5517 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13387 | DUF4105 | Domain of unknown function (DUF4105) | 101 | 235 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.