Protein Family IF08146
Metagenome
Isolate
119
Members
38
Samples
114
Scaffolds
352.55
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_278216|Ga0466723_278216_3483_4664
- Length
- 393 aa
- Sequence
- LPENFLEKKEAPQELSKVFLIKFLLEALGKKFMTWILRTLAVLFIFLAPLSCSSQDSNNPQTSSKNSEITVIFIPKITGNAFFEAASVGAKEYASRHGFQVDYQGYPEADVSKQIEIIERAIANKATAISVSSLDAKALDPVLMKALKAGIKVTTWDSDVSGNARLIMISQGTPSQLGKMLVEMAVKSLDKRGKNPASDPIRYAWHYSQASVADQNSWRVAGEEYIHDVYPNWINVNPENFYSMQDPARALSVGKEIISAHPDIDVIICNDSTSLPGQAQALQELGLGANDVTVTGFSPPNAMREYAKAGIIDRWGLWDCQIQGALACYIAYYLASGNQLNVGQMVDVPEIGLIEVMPNTVLDPGAYTAPNSGVVLLPRRTEFTAENVDDYNF
Sample Types
Isolate
4.2%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Termitidae
28.9%
Unclassified
18.4%
Rhinotermitidae
7.9%
Termopsidae
5.3%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 24 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 35 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10037685 | 3300002450 | Bacteria | 2195 |
| 2 | Ga0466690_117737 | 3300042590 | Bacteria | 3211 |
| 3 | Ga0466691_082353 | 3300042593 | Bacteria | 10592 |
| 4 | Ga0466691_162741 | 3300042593 | Bacteria | 25322 |
| 5 | Ga0466706_115144 | 3300042599 | Bacteria | 2597 |
| 6 | Ga0466713_039544 | 3300042602 | Bacteria | 3663 |
| 7 | Ga0466705_412283 | 3300042612 | Bacteria | 1844 |
| 8 | Ga0466711_458388 | 3300042615 | Bacteria | 4742 |
| 9 | Ga0466715_246965 | 3300042616 | Bacteria | 4367 |
| 10 | Ga0466723_306094 | 3300042618 | Bacteria | 2616 |
| 11 | Ga0466726_421544 | 3300042619 | Bacteria | 2417 |
| 12 | Ga0466705_214068 | 3300042612 | Bacteria | 3497 |
| 13 | Ga0466729_259264 | 3300042621 | Bacteria | 1819 |
| 14 | Ga0466735_157925 | 3300042624 | Bacteria | 2870 |
| 15 | Ga0466703_037504 | 3300042636 | Unclassified | 2072 |
| 16 | Ga0466703_060122 | 3300042636 | Bacteria | 3815 |
| 17 | Ga0466709_088864 | 3300042648 | Bacteria | 2007 |
| 18 | Ga0466709_378036 | 3300042648 | Bacteria | 6168 |
| 19 | Ga0466708_030544 | 3300042652 | Bacteria | 1335 |
| 20 | Ga0466708_391997 | 3300042652 | Bacteria | 3099 |
| 21 | Ga0466690_103893 | 3300042590 | Bacteria | 3641 |
| 22 | Ga0466695_106144 | 3300042595 | Bacteria | 1556 |
| 23 | Ga0466707_398475 | 3300042601 | Bacteria | 1082 |
| 24 | Ga0466716_086539 | 3300042605 | Bacteria | 3248 |
| 25 | Ga0466719_085807 | 3300042606 | Bacteria | 4691 |
| 26 | Ga0466719_412222 | 3300042606 | Bacteria | 1315 |
| 27 | Ga0466711_347466 | 3300042615 | Bacteria | 7122 |
| 28 | Ga0466715_016537 | 3300042616 | Bacteria | 14222 |
| 29 | Ga0466715_387404 | 3300042616 | Bacteria | 5122 |
| 30 | Ga0466726_349239 | 3300042619 | Bacteria | 1443 |
| 31 | Ga0466726_353624 | 3300042619 | Bacteria | 4352 |
| 32 | Ga0466705_245023 | 3300042612 | Bacteria | 21288 |
| 33 | Ga0466729_261430 | 3300042621 | Bacteria | 26177 |
| 34 | Ga0466735_140941 | 3300042624 | Bacteria | 3200 |
| 35 | Ga0466703_231435 | 3300042636 | Bacteria | 27613 |
| 36 | Ga0466704_007510 | 3300042643 | Unclassified | 7159 |
| 37 | Ga0466708_153088 | 3300042652 | Bacteria | 21028 |
| 38 | Ga0466693_186663 | 3300042592 | Bacteria | 8955 |
| 39 | Ga0466691_133708 | 3300042593 | Bacteria | 23029 |
| 40 | Ga0466691_187892 | 3300042593 | Bacteria | 2414 |
| 41 | Ga0466707_413381 | 3300042601 | Bacteria | 2051 |
| 42 | Ga0466713_094003 | 3300042602 | Bacteria | 21513 |
| 43 | Ga0466717_151008 | 3300042604 | Bacteria | 16555 |
| 44 | Ga0466719_293885 | 3300042606 | Bacteria | 7388 |
| 45 | Ga0466703_013427 | 3300042636 | Bacteria | 5595 |
| 46 | Ga0466690_053199 | 3300042590 | Bacteria | 4367 |
| 47 | Ga0466690_062952 | 3300042590 | Bacteria | 6987 |
| 48 | Ga0466691_070720 | 3300042593 | Bacteria | 8035 |
| 49 | Ga0466719_261154 | 3300042606 | Bacteria | 11097 |
| 50 | Ga0466705_495859 | 3300042612 | Bacteria | 8033 |
| 51 | Ga0466715_254529 | 3300042616 | Bacteria | 7300 |
| 52 | Ga0466715_420395 | 3300042616 | Bacteria | 5308 |
| 53 | Ga0466723_014744 | 3300042618 | Bacteria | 29092 |
| 54 | Ga0466723_076653 | 3300042618 | Bacteria | 13881 |
| 55 | Ga0466704_042914 | 3300042643 | Bacteria | 7219 |
| 56 | Ga0466709_143484 | 3300042648 | Bacteria | 162355 |
| 57 | Ga0466692_136704 | 3300042591 | Bacteria | 4420 |
| 58 | Ga0466716_277485 | 3300042605 | Bacteria | 6940 |
| 59 | Ga0466722_117569 | 3300042609 | Bacteria | 36546 |
| 60 | Ga0466722_253580 | 3300042609 | Bacteria | 4274 |
| 61 | Ga0466711_249608 | 3300042615 | Bacteria | 11268 |
| 62 | Ga0466715_056935 | 3300042616 | Bacteria | 2962 |
| 63 | Ga0466715_104840 | 3300042616 | Bacteria | 52795 |
| 64 | Ga0466715_124791 | 3300042616 | Bacteria | 5765 |
| 65 | Ga0466715_174171 | 3300042616 | Bacteria | 4924 |
| 66 | Ga0466715_237490 | 3300042616 | Bacteria | 8390 |
| 67 | Ga0466723_041583 | 3300042618 | Bacteria | 3735 |
| 68 | Ga0466723_219907 | 3300042618 | Bacteria | 1858 |
| 69 | Ga0466723_222863 | 3300042618 | Bacteria | 36841 |
| 70 | Ga0466723_298179 | 3300042618 | Bacteria | 12304 |
| 71 | Ga0466728_042173 | 3300042620 | Bacteria | 1399 |
| 72 | Ga0466703_237663 | 3300042636 | Bacteria | 27703 |
| 73 | Ga0072940_1006750 | 3300005200 | Unclassified | 5465 |
| 74 | Ga0466691_217383 | 3300042593 | Bacteria | 8251 |
| 75 | Ga0466707_156209 | 3300042601 | Bacteria | 1688 |
| 76 | Ga0466712_180841 | 3300042614 | Bacteria | 2069 |
| 77 | Ga0466711_028236 | 3300042615 | Bacteria | 8690 |
| 78 | Ga0466711_241365 | 3300042615 | Bacteria | 14389 |
| 79 | Ga0466715_268147 | 3300042616 | Bacteria | 9723 |
| 80 | Ga0466723_047750 | 3300042618 | Bacteria | 8066 |
| 81 | Ga0466723_278216 | 3300042618 | Bacteria | 6800 |
| 82 | Ga0466728_222528 | 3300042620 | Bacteria | 13303 |
| 83 | Ga0466705_126427 | 3300042612 | Bacteria | 20907 |
| 84 | Ga0466729_217107 | 3300042621 | Bacteria | 2119 |
| 85 | Ga0466704_263668 | 3300042643 | Unclassified | 8948 |
| 86 | Ga0466732_399151 | 3300042656 | Bacteria | 7107 |
| 87 | Ga0415639_083977 | 3300038395 | Unclassified | 4628 |
| 88 | Ga0466690_289029 | 3300042590 | Bacteria | 1769 |
| 89 | Ga0466692_003835 | 3300042591 | Bacteria | 1716 |
| 90 | Ga0466696_204756 | 3300042596 | Bacteria | 10800 |
| 91 | Ga0123353_10097506 | 3300010167 | Bacteria | 4738 |
| 92 | Ga0466713_151633 | 3300042602 | Bacteria | 10085 |
| 93 | Ga0466722_160345 | 3300042609 | Bacteria | 1419 |
| 94 | Ga0466722_168877 | 3300042609 | Bacteria | 5358 |
| 95 | Ga0466705_484358 | 3300042612 | Bacteria | 2491 |
| 96 | Ga0466711_091961 | 3300042615 | Bacteria | 2974 |
| 97 | Ga0466723_241174 | 3300042618 | Bacteria | 4535 |
| 98 | Ga0466723_275199 | 3300042618 | Unclassified | 7464 |
| 99 | Ga0466735_223510 | 3300042624 | Bacteria | 3576 |
| 100 | Ga0466704_136420 | 3300042643 | Bacteria | 13703 |
| 101 | Ga0466708_040294 | 3300042652 | Bacteria | 5869 |
| 102 | AustNasuHG_c1000319 | 3300000089 | Bacteria | 16758 |
| 103 | Ga0466732_188806 | 3300042656 | Bacteria | 1578 |
| 104 | Ga0466690_008210 | 3300042590 | Bacteria | 3966 |
| 105 | Ga0466691_041099 | 3300042593 | Bacteria | 14815 |
| 106 | Ga0466696_167001 | 3300042596 | Unclassified | 1450 |
| 107 | Ga0466705_455225 | 3300042612 | Bacteria | 3774 |
| 108 | Ga0466715_151694 | 3300042616 | Bacteria | 5706 |
| 109 | Ga0466718_145948 | 3300042617 | Bacteria | 5798 |
| 110 | Ga0466723_099969 | 3300042618 | Bacteria | 53553 |
| 111 | Ga0466728_010251 | 3300042620 | Bacteria | 21388 |
| 112 | Ga0466735_015230 | 3300042624 | Bacteria | 13305 |
| 113 | Ga0466703_071094 | 3300042636 | Bacteria | 12043 |
| 114 | Ga0466709_188758 | 3300042648 | Bacteria | 4614 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13407 | Peripla_BP_4 | Periplasmic binding protein domain | 72 | 338 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.