Protein Family IF08129
Metagenome
Isolate
211
Members
47
Samples
204
Scaffolds
266.19
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_245776|Ga0466723_245776_1004_1981
- Length
- 325 aa
- Sequence
- LEQPPAFGNRVVQKLQFLNNNRLKTAKNMDFVGKSAFFGRLERPDSRTSPISIEGAMKKFFFSFIIILALAALAFFAGWAQLAVPPGSVGVMRSKTHGLDAELIQEGEFRWVWFKLIPTNVTISVFRLDERRYSLSIKNTLPSAGVYSAFMGITNDFSYELSASLFYSLDEKFLISLIKEHSIDGQDKLDAFEEDISGKIQTFVQGRLSSGSDYTDDLEEILASGRSPALEKDIQTAFPYIKNVSCLITAAVFPDFALYRQIRGFYEDYLEKQREYLSSGMNLNAENHINARFRFDELEKYGELLTKYPILIQYLSIEKGQVTPP
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.8%
Kalotermitidae
31.1%
Unclassified
20.0%
Termopsidae
6.7%
Rhinotermitidae
4.4%
Taxonomy
Archaea
1
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 20 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 23 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1001157 | 3300000089 | Bacteria | 9469 |
| 2 | JGI24695J34938_10000184 | 3300002450 | Bacteria | 58384 |
| 3 | JGI24695J34938_10003393 | 3300002450 | Bacteria | 11176 |
| 4 | Ga0072941_1000658 | 3300005201 | Bacteria | 45520 |
| 5 | Ga0072941_1011734 | 3300005201 | Bacteria | 4207 |
| 6 | Ga0072941_1210425 | 3300005201 | Bacteria | 2268 |
| 7 | Ga0466731_371765 | 3300042622 | Bacteria | 2079 |
| 8 | Ga0466702_003226 | 3300042635 | Bacteria | 17212 |
| 9 | Ga0466703_050941 | 3300042636 | Bacteria | 2519 |
| 10 | Ga0466703_094735 | 3300042636 | Bacteria | 23319 |
| 11 | Ga0466709_265144 | 3300042648 | Bacteria | 3470 |
| 12 | Ga0466709_378970 | 3300042648 | Bacteria | 2943 |
| 13 | Ga0466727_140726 | 3300042655 | Bacteria | 4273 |
| 14 | Ga0466690_135472 | 3300042590 | Bacteria | 3465 |
| 15 | Ga0466691_021413 | 3300042593 | Unclassified | 7002 |
| 16 | Ga0466696_050274 | 3300042596 | Bacteria | 6091 |
| 17 | Ga0466699_125369 | 3300042597 | Bacteria | 7894 |
| 18 | Ga0466711_378858 | 3300042615 | Bacteria | 1825 |
| 19 | Ga0466715_061122 | 3300042616 | Bacteria | 3503 |
| 20 | Ga0466715_546470 | 3300042616 | Bacteria | 3282 |
| 21 | Ga0466718_105899 | 3300042617 | Bacteria | 13365 |
| 22 | Ga0466718_143126 | 3300042617 | Bacteria | 6744 |
| 23 | Ga0466723_301989 | 3300042618 | Bacteria | 26238 |
| 24 | Ga0466726_117186 | 3300042619 | Bacteria | 1448 |
| 25 | Ga0466728_221780 | 3300042620 | Bacteria | 1609 |
| 26 | Ga0466728_387889 | 3300042620 | Bacteria | 1586 |
| 27 | Ga0466722_004074 | 3300042609 | Bacteria | 6709 |
| 28 | Ga0466698_384894 | 3300042610 | Bacteria | 1255 |
| 29 | Ga0466732_214374 | 3300042656 | Bacteria | 6892 |
| 30 | JGI24695J34938_10014590 | 3300002450 | Bacteria | 4065 |
| 31 | Ga0466705_343552 | 3300042612 | Bacteria | 8895 |
| 32 | Ga0466703_146267 | 3300042636 | Bacteria | 24001 |
| 33 | Ga0466703_347385 | 3300042636 | Bacteria | 2616 |
| 34 | Ga0466704_239661 | 3300042643 | Bacteria | 53688 |
| 35 | Ga0466709_073930 | 3300042648 | Bacteria | 28320 |
| 36 | Ga0466690_135777 | 3300042590 | Bacteria | 6362 |
| 37 | Ga0466691_020090 | 3300042593 | Bacteria | 2865 |
| 38 | Ga0123356_10075217 | 3300010049 | Bacteria | 3181 |
| 39 | Ga0466712_121410 | 3300042614 | Bacteria | 6430 |
| 40 | Ga0466715_042848 | 3300042616 | Bacteria | 2004 |
| 41 | Ga0466715_324226 | 3300042616 | Bacteria | 10437 |
| 42 | Ga0466715_416166 | 3300042616 | Bacteria | 12352 |
| 43 | Ga0466715_604413 | 3300042616 | Bacteria | 2786 |
| 44 | Ga0466718_163979 | 3300042617 | Bacteria | 5032 |
| 45 | Ga0466728_109387 | 3300042620 | Bacteria | 15237 |
| 46 | Ga0466719_447841 | 3300042606 | Bacteria | 2673 |
| 47 | Ga0466719_571828 | 3300042606 | Bacteria | 4391 |
| 48 | Ga0466720_009521 | 3300042607 | Bacteria | 7669 |
| 49 | Ga0466720_016494 | 3300042607 | Bacteria | 1295 |
| 50 | Ga0466722_247457 | 3300042609 | Bacteria | 5122 |
| 51 | AustNasuHG_c1021477 | 3300000089 | Unclassified | 2089 |
| 52 | JGI24698J34947_10019353 | 3300002449 | Bacteria | 3672 |
| 53 | JGI24698J34947_10144109 | 3300002449 | Bacteria | 999 |
| 54 | Ga0072940_1041601 | 3300005200 | Bacteria | 5650 |
| 55 | Ga0466705_004024 | 3300042612 | Bacteria | 2675 |
| 56 | Ga0466727_276824 | 3300042655 | Bacteria | 1659 |
| 57 | Ga0466727_327391 | 3300042655 | Bacteria | 2645 |
| 58 | Ga0264413_115712 | 3300024493 | Bacteria | 1809 |
| 59 | Ga0466690_009534 | 3300042590 | Bacteria | 1081 |
| 60 | Ga0466691_160250 | 3300042593 | Bacteria | 3847 |
| 61 | Ga0466694_043554 | 3300042594 | Bacteria | 14346 |
| 62 | Ga0466694_097575 | 3300042594 | Bacteria | 31512 |
| 63 | Ga0466696_093034 | 3300042596 | Bacteria | 4149 |
| 64 | Ga0466696_377903 | 3300042596 | Bacteria | 1026 |
| 65 | Ga0123355_10446265 | 3300009826 | Unclassified | 1634 |
| 66 | Ga0466711_227909 | 3300042615 | Bacteria | 4626 |
| 67 | Ga0466711_313972 | 3300042615 | Bacteria | 2990 |
| 68 | Ga0466711_462412 | 3300042615 | Bacteria | 2775 |
| 69 | Ga0466715_021799 | 3300042616 | Bacteria | 20987 |
| 70 | Ga0466718_145678 | 3300042617 | Bacteria | 7214 |
| 71 | Ga0466723_317213 | 3300042618 | Bacteria | 24185 |
| 72 | Ga0466726_286629 | 3300042619 | Bacteria | 1407 |
| 73 | Ga0466728_217251 | 3300042620 | Bacteria | 3489 |
| 74 | Ga0466728_229254 | 3300042620 | Bacteria | 3543 |
| 75 | Ga0466728_239722 | 3300042620 | Bacteria | 8695 |
| 76 | Ga0466716_378792 | 3300042605 | Unclassified | 3577 |
| 77 | Ga0466719_101633 | 3300042606 | Bacteria | 6278 |
| 78 | Ga0466719_255652 | 3300042606 | Bacteria | 23654 |
| 79 | Ga0466720_012388 | 3300042607 | Bacteria | 2988 |
| 80 | Ga0466720_037341 | 3300042607 | Bacteria | 13381 |
| 81 | Ga0466722_082473 | 3300042609 | Bacteria | 31404 |
| 82 | AustNasuHG_c1020708 | 3300000089 | Bacteria | 2138 |
| 83 | AustNasuHG_c1026765 | 3300000089 | Bacteria | 1788 |
| 84 | JGI24698J34947_10055985 | 3300002449 | Archaea | 1963 |
| 85 | Ga0072940_1053390 | 3300005200 | Bacteria | 4824 |
| 86 | Ga0072941_1000656 | 3300005201 | Bacteria | 48279 |
| 87 | Ga0072941_1001626 | 3300005201 | Bacteria | 73081 |
| 88 | Ga0072941_1006223 | 3300005201 | Bacteria | 5705 |
| 89 | Ga0072941_1018443 | 3300005201 | Bacteria | 8202 |
| 90 | Ga0466703_169198 | 3300042636 | Bacteria | 4003 |
| 91 | Ga0466704_033644 | 3300042643 | Bacteria | 5201 |
| 92 | Ga0466704_336611 | 3300042643 | Bacteria | 10880 |
| 93 | Ga0466709_318277 | 3300042648 | Bacteria | 1572 |
| 94 | Ga0466708_082784 | 3300042652 | Bacteria | 24752 |
| 95 | Ga0466708_154725 | 3300042652 | Bacteria | 3356 |
| 96 | Ga0466727_033228 | 3300042655 | Bacteria | 3109 |
| 97 | Ga0466727_273275 | 3300042655 | Bacteria | 2232 |
| 98 | Ga0264413_100395 | 3300024493 | Bacteria | 10081 |
| 99 | Ga0466690_122397 | 3300042590 | Bacteria | 2116 |
| 100 | Ga0466691_052089 | 3300042593 | Bacteria | 4766 |
| 101 | Ga0466694_238424 | 3300042594 | Bacteria | 2309 |
| 102 | Ga0466696_265566 | 3300042596 | Bacteria | 1667 |
| 103 | Ga0466696_300256 | 3300042596 | Bacteria | 22705 |
| 104 | Ga0466699_059102 | 3300042597 | Bacteria | 11909 |
| 105 | Ga0466705_479367 | 3300042612 | Bacteria | 6068 |
| 106 | Ga0466712_033790 | 3300042614 | Bacteria | 23879 |
| 107 | Ga0466718_093687 | 3300042617 | Bacteria | 8950 |
| 108 | Ga0466713_128849 | 3300042602 | Bacteria | 12841 |
| 109 | Ga0466720_038655 | 3300042607 | Bacteria | 16892 |
| 110 | Ga0466720_150019 | 3300042607 | Bacteria | 39884 |
| 111 | Ga0466732_179491 | 3300042656 | Bacteria | 3226 |
| 112 | JGI24698J34947_10002124 | 3300002449 | Bacteria | 10609 |
| 113 | JGI24698J34947_10033224 | 3300002449 | Unclassified | 2707 |
| 114 | JGI24695J34938_10000135 | 3300002450 | Bacteria | 66811 |
| 115 | Ga0072941_1003697 | 3300005201 | Bacteria | 5089 |
| 116 | Ga0072941_1022545 | 3300005201 | Bacteria | 4432 |
| 117 | Ga0072941_1077519 | 3300005201 | Bacteria | 4965 |
| 118 | Ga0466703_100316 | 3300042636 | Bacteria | 15912 |
| 119 | Ga0466704_112114 | 3300042643 | Bacteria | 18741 |
| 120 | Ga0466708_153221 | 3300042652 | Unclassified | 2994 |
| 121 | Ga0466727_065346 | 3300042655 | Bacteria | 6612 |
| 122 | Ga0466690_025542 | 3300042590 | Bacteria | 7373 |
| 123 | Ga0466691_185506 | 3300042593 | Bacteria | 2228 |
| 124 | Ga0123357_10018528 | 3300009784 | Bacteria | 9258 |
| 125 | Ga0466715_285471 | 3300042616 | Bacteria | 1273 |
| 126 | Ga0466718_085248 | 3300042617 | Unclassified | 3475 |
| 127 | Ga0466718_094985 | 3300042617 | Bacteria | 2297 |
| 128 | Ga0466718_138807 | 3300042617 | Bacteria | 10496 |
| 129 | Ga0466728_039682 | 3300042620 | Bacteria | 1599 |
| 130 | Ga0466728_056535 | 3300042620 | Bacteria | 4599 |
| 131 | Ga0466728_229940 | 3300042620 | Bacteria | 3761 |
| 132 | Ga0466707_260103 | 3300042601 | Bacteria | 2406 |
| 133 | Ga0466716_052303 | 3300042605 | Bacteria | 12390 |
| 134 | Ga0466716_414490 | 3300042605 | Bacteria | 2149 |
| 135 | Ga0466720_001948 | 3300042607 | Bacteria | 13369 |
| 136 | Ga0466722_082377 | 3300042609 | Bacteria | 2293 |
| 137 | Ga0466732_161367 | 3300042656 | Bacteria | 5244 |
| 138 | Ga0466732_210974 | 3300042656 | Bacteria | 6944 |
| 139 | AustNasuHG_c1014427 | 3300000089 | Bacteria | 2688 |
| 140 | JGI24695J34938_10002350 | 3300002450 | Bacteria | 14566 |
| 141 | JGI24702J35022_10039565 | 3300002462 | Bacteria | 2515 |
| 142 | Ga0072941_1160864 | 3300005201 | Bacteria | 3102 |
| 143 | Ga0466731_335439 | 3300042622 | Bacteria | 6676 |
| 144 | Ga0466735_011509 | 3300042624 | Bacteria | 5844 |
| 145 | Ga0466708_220875 | 3300042652 | Bacteria | 7168 |
| 146 | Ga0466727_068173 | 3300042655 | Bacteria | 1206 |
| 147 | Ga0466690_026437 | 3300042590 | Bacteria | 2002 |
| 148 | Ga0466690_239590 | 3300042590 | Bacteria | 5323 |
| 149 | Ga0466692_142005 | 3300042591 | Bacteria | 2247 |
| 150 | Ga0466692_161720 | 3300042591 | Bacteria | 2935 |
| 151 | Ga0466691_036492 | 3300042593 | Bacteria | 8044 |
| 152 | Ga0466694_179026 | 3300042594 | Bacteria | 5437 |
| 153 | Ga0123356_10036742 | 3300010049 | Unclassified | 4572 |
| 154 | Ga0466705_483728 | 3300042612 | Unclassified | 2980 |
| 155 | Ga0466712_003444 | 3300042614 | Bacteria | 10314 |
| 156 | Ga0466712_257821 | 3300042614 | Bacteria | 2126 |
| 157 | Ga0466715_323785 | 3300042616 | Bacteria | 1718 |
| 158 | Ga0466715_407342 | 3300042616 | Bacteria | 4405 |
| 159 | Ga0466726_263671 | 3300042619 | Bacteria | 2023 |
| 160 | Ga0466726_342713 | 3300042619 | Bacteria | 2100 |
| 161 | Ga0466728_104815 | 3300042620 | Bacteria | 3880 |
| 162 | Ga0466716_432847 | 3300042605 | Bacteria | 1805 |
| 163 | Ga0466720_091367 | 3300042607 | Bacteria | 3604 |
| 164 | Ga0466720_122505 | 3300042607 | Unclassified | 1755 |
| 165 | Ga0072940_1033337 | 3300005200 | Bacteria | 7489 |
| 166 | Ga0072940_1033585 | 3300005200 | Bacteria | 5559 |
| 167 | Ga0072941_1004151 | 3300005201 | Bacteria | 14706 |
| 168 | Ga0072941_1022579 | 3300005201 | Unclassified | 11100 |
| 169 | Ga0466705_121550 | 3300042612 | Bacteria | 4461 |
| 170 | Ga0466703_014576 | 3300042636 | Bacteria | 6469 |
| 171 | Ga0466704_052533 | 3300042643 | Bacteria | 38076 |
| 172 | Ga0466708_275854 | 3300042652 | Bacteria | 4242 |
| 173 | Ga0466691_004182 | 3300042593 | Bacteria | 8359 |
| 174 | Ga0466694_037050 | 3300042594 | Bacteria | 8719 |
| 175 | Ga0466694_109036 | 3300042594 | Bacteria | 2453 |
| 176 | Ga0466699_336635 | 3300042597 | Bacteria | 2895 |
| 177 | Ga0466699_421823 | 3300042597 | Bacteria | 1648 |
| 178 | Ga0466715_141275 | 3300042616 | Bacteria | 11984 |
| 179 | Ga0466715_434733 | 3300042616 | Bacteria | 13167 |
| 180 | Ga0466718_016764 | 3300042617 | Bacteria | 1155 |
| 181 | Ga0466723_245776 | 3300042618 | Bacteria | 2153 |
| 182 | Ga0466726_147521 | 3300042619 | Bacteria | 4800 |
| 183 | Ga0466719_034491 | 3300042606 | Bacteria | 17517 |
| 184 | Ga0466719_500611 | 3300042606 | Bacteria | 1673 |
| 185 | Ga0466719_503680 | 3300042606 | Bacteria | 7631 |
| 186 | Ga0466720_017944 | 3300042607 | Bacteria | 63542 |
| 187 | Ga0466732_061932 | 3300042656 | Bacteria | 8486 |
| 188 | JGI24698J34947_10008856 | 3300002449 | Bacteria | 5524 |
| 189 | JGI24698J34947_10010541 | 3300002449 | Bacteria | 5072 |
| 190 | JGI24698J34947_10012769 | 3300002449 | Unclassified | 4597 |
| 191 | JGI24695J34938_10000012 | 3300002450 | Bacteria | 126955 |
| 192 | Ga0466735_025271 | 3300042624 | Bacteria | 18955 |
| 193 | Ga0466709_182611 | 3300042648 | Bacteria | 2644 |
| 194 | Ga0466709_301071 | 3300042648 | Bacteria | 15848 |
| 195 | Ga0466709_416823 | 3300042648 | Bacteria | 4108 |
| 196 | Ga0264413_114036 | 3300024493 | Unclassified | 4830 |
| 197 | Ga0264413_114252 | 3300024493 | Bacteria | 5343 |
| 198 | Ga0466696_404531 | 3300042596 | Bacteria | 3345 |
| 199 | Ga0466712_213046 | 3300042614 | Bacteria | 29376 |
| 200 | Ga0466712_235790 | 3300042614 | Bacteria | 2684 |
| 201 | Ga0466715_305646 | 3300042616 | Bacteria | 5684 |
| 202 | Ga0466728_319781 | 3300042620 | Bacteria | 3774 |
| 203 | Ga0466719_271731 | 3300042606 | Bacteria | 1183 |
| 204 | Ga0466722_191323 | 3300042609 | Bacteria | 6741 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.