Protein Family IF08067
Metagenome
Isolate
171
Members
45
Samples
169
Scaffolds
189.88
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_116213|Ga0466723_116213_9301_9996
- Length
- 231 aa
- Sequence
- LWRRPWASLGFHFANRGEKDYTTTNGPDKNERSGNLDFQENKMAVKAMDLFDAYAQNKLPKDNAYVVSSFVNANSGYVIYEVVSYSGVKAIYLEGSGITFQSQGKKMHILIEPASYSHKGIEPYLRDTGEKIPLRFSELEILTAKNQTKAMVSKKPIESLSSFTIMKPSGLNISFVFYSNPDMYRTLETFFEKSFNQDGGIPQADAKKAAKTTAALIEKNMSFKSDFGNAT
Sample Types
Isolate
1.2%
Metagenome
98.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Kalotermitidae
32.6%
Termopsidae
9.3%
Rhinotermitidae
7.0%
Unclassified
7.0%
Taxonomy
Archaea
2
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_071390 | 3300042612 | Bacteria | 4137 |
| 2 | Ga0466705_250564 | 3300042612 | Bacteria | 23311 |
| 3 | Ga0466705_319617 | 3300042612 | Unclassified | 1195 |
| 4 | Ga0123356_10004424 | 3300010049 | Bacteria | 14526 |
| 5 | Ga0123356_12440235 | 3300010049 | Bacteria | 654 |
| 6 | Ga0466696_310380 | 3300042596 | Bacteria | 12859 |
| 7 | Ga0466719_530756 | 3300042606 | Bacteria | 2433 |
| 8 | Ga0466722_097753 | 3300042609 | Bacteria | 10736 |
| 9 | Ga0466723_328799 | 3300042618 | Bacteria | 8842 |
| 10 | Ga0466726_374275 | 3300042619 | Bacteria | 4161 |
| 11 | Ga0466728_089552 | 3300042620 | Bacteria | 20901 |
| 12 | Ga0466728_126343 | 3300042620 | Bacteria | 2430 |
| 13 | Ga0466728_346141 | 3300042620 | Archaea | 11237 |
| 14 | Ga0466703_156880 | 3300042636 | Bacteria | 1766 |
| 15 | Ga0466703_171636 | 3300042636 | Bacteria | 6993 |
| 16 | Ga0466704_218017 | 3300042643 | Bacteria | 21019 |
| 17 | Ga0466704_571267 | 3300042643 | Bacteria | 5451 |
| 18 | Ga0466708_222722 | 3300042652 | Bacteria | 3229 |
| 19 | Ga0466708_325537 | 3300042652 | Bacteria | 1830 |
| 20 | Ga0466708_351454 | 3300042652 | Bacteria | 9173 |
| 21 | Ga0466705_043003 | 3300042612 | Unclassified | 11223 |
| 22 | Ga0466705_143689 | 3300042612 | Bacteria | 1087 |
| 23 | Ga0466705_361794 | 3300042612 | Bacteria | 1584 |
| 24 | Ga0466733_060028 | 3300042659 | Bacteria | 1724 |
| 25 | Ga0123356_10581944 | 3300010049 | Bacteria | 1283 |
| 26 | Ga0123353_10523092 | 3300010167 | Bacteria | 1720 |
| 27 | Ga0466690_309914 | 3300042590 | Unclassified | 1287 |
| 28 | Ga0466691_013385 | 3300042593 | Bacteria | 15469 |
| 29 | Ga0466699_321391 | 3300042597 | Bacteria | 2526 |
| 30 | Ga0466699_426686 | 3300042597 | Bacteria | 3798 |
| 31 | Ga0466715_501402 | 3300042616 | Bacteria | 4201 |
| 32 | Ga0466718_020186 | 3300042617 | Bacteria | 16920 |
| 33 | Ga0466726_421529 | 3300042619 | Bacteria | 1485 |
| 34 | Ga0466704_355363 | 3300042643 | Bacteria | 9076 |
| 35 | Ga0466727_175817 | 3300042655 | Bacteria | 2361 |
| 36 | Ga0466727_317428 | 3300042655 | Bacteria | 2082 |
| 37 | Ga0466705_149367 | 3300042612 | Bacteria | 19442 |
| 38 | Ga0123353_10031432 | 3300010167 | Bacteria | 8224 |
| 39 | Ga0123354_10253455 | 3300010882 | Bacteria | 1777 |
| 40 | Ga0466693_086470 | 3300042592 | Bacteria | 29609 |
| 41 | Ga0466693_234011 | 3300042592 | Bacteria | 1711 |
| 42 | Ga0466691_017701 | 3300042593 | Bacteria | 9126 |
| 43 | Ga0466691_072570 | 3300042593 | Bacteria | 7652 |
| 44 | Ga0466691_198616 | 3300042593 | Unclassified | 3042 |
| 45 | Ga0466694_297779 | 3300042594 | Bacteria | 7981 |
| 46 | Ga0466695_152745 | 3300042595 | Bacteria | 2022 |
| 47 | Ga0466696_069913 | 3300042596 | Bacteria | 20704 |
| 48 | Ga0466696_141389 | 3300042596 | Bacteria | 8856 |
| 49 | Ga0466696_249054 | 3300042596 | Bacteria | 7270 |
| 50 | Ga0466696_355943 | 3300042596 | Bacteria | 1045 |
| 51 | Ga0466707_009944 | 3300042601 | Bacteria | 2133 |
| 52 | Ga0466719_189561 | 3300042606 | Bacteria | 9352 |
| 53 | Ga0466711_007352 | 3300042615 | Bacteria | 10471 |
| 54 | Ga0466711_118969 | 3300042615 | Bacteria | 22188 |
| 55 | Ga0466726_402898 | 3300042619 | Bacteria | 1571 |
| 56 | Ga0466728_248930 | 3300042620 | Bacteria | 8307 |
| 57 | Ga0466702_077371 | 3300042635 | Bacteria | 3252 |
| 58 | Ga0466703_130914 | 3300042636 | Archaea | 10022 |
| 59 | Ga0466704_243222 | 3300042643 | Bacteria | 18857 |
| 60 | Ga0466709_251953 | 3300042648 | Bacteria | 7366 |
| 61 | Ga0466727_090701 | 3300042655 | Bacteria | 1001 |
| 62 | JGI24698J34947_10006684 | 3300002449 | Bacteria | 6333 |
| 63 | JGI24698J34947_10117049 | 3300002449 | Bacteria | 1164 |
| 64 | Ga0068302_10600120 | 3300005071 | Unclassified | 1144 |
| 65 | Ga0466705_058976 | 3300042612 | Bacteria | 1167 |
| 66 | Ga0123357_10201312 | 3300009784 | Bacteria | 2265 |
| 67 | Ga0123355_10436805 | 3300009826 | Bacteria | 1660 |
| 68 | Ga0123356_10303623 | 3300010049 | Bacteria | 1702 |
| 69 | Ga0123353_11068359 | 3300010167 | Bacteria | 1076 |
| 70 | Ga0123354_10196911 | 3300010882 | Bacteria | 2232 |
| 71 | Ga0415639_015002 | 3300038395 | Bacteria | 8627 |
| 72 | Ga0466690_108747 | 3300042590 | Unclassified | 2100 |
| 73 | Ga0466690_247677 | 3300042590 | Unclassified | 2994 |
| 74 | Ga0466690_251730 | 3300042590 | Unclassified | 5857 |
| 75 | Ga0466716_159067 | 3300042605 | Bacteria | 21811 |
| 76 | Ga0466716_254098 | 3300042605 | Unclassified | 2154 |
| 77 | Ga0466716_426061 | 3300042605 | Unclassified | 1350 |
| 78 | Ga0466719_574741 | 3300042606 | Bacteria | 1184 |
| 79 | Ga0466712_115906 | 3300042614 | Bacteria | 7210 |
| 80 | Ga0466711_090425 | 3300042615 | Bacteria | 1415 |
| 81 | Ga0466726_216860 | 3300042619 | Bacteria | 19475 |
| 82 | Ga0466729_220314 | 3300042621 | Bacteria | 1331 |
| 83 | Ga0466735_021955 | 3300042624 | Bacteria | 6449 |
| 84 | Ga0466704_240202 | 3300042643 | Bacteria | 15794 |
| 85 | Ga0466709_121900 | 3300042648 | Bacteria | 5327 |
| 86 | Ga0466709_293637 | 3300042648 | Bacteria | 12811 |
| 87 | Ga0466708_092644 | 3300042652 | Bacteria | 3201 |
| 88 | JGI24695J34938_10022695 | 3300002450 | Unclassified | 3040 |
| 89 | JGI24702J35022_10090545 | 3300002462 | Bacteria | 1665 |
| 90 | Ga0072940_1017975 | 3300005200 | Bacteria | 1640 |
| 91 | Ga0466705_218609 | 3300042612 | Bacteria | 2532 |
| 92 | Ga0466705_230707 | 3300042612 | Bacteria | 2416 |
| 93 | Ga0123357_10300101 | 3300009784 | Bacteria | 1624 |
| 94 | Ga0123357_10300113 | 3300009784 | Bacteria | 1624 |
| 95 | Ga0123356_10085429 | 3300010049 | Bacteria | 2993 |
| 96 | Ga0123356_10144037 | 3300010049 | Bacteria | 2355 |
| 97 | Ga0123353_10027297 | 3300010167 | Bacteria | 8746 |
| 98 | Ga0123353_10190399 | 3300010167 | Bacteria | 3239 |
| 99 | Ga0466692_177098 | 3300042591 | Bacteria | 5221 |
| 100 | Ga0466691_110425 | 3300042593 | Bacteria | 9271 |
| 101 | Ga0466716_066915 | 3300042605 | Bacteria | 4977 |
| 102 | Ga0466716_376438 | 3300042605 | Bacteria | 3144 |
| 103 | Ga0466719_240647 | 3300042606 | Bacteria | 6036 |
| 104 | Ga0466719_255578 | 3300042606 | Bacteria | 3659 |
| 105 | Ga0466712_130102 | 3300042614 | Bacteria | 14039 |
| 106 | Ga0466715_089439 | 3300042616 | Bacteria | 2145 |
| 107 | Ga0466715_156379 | 3300042616 | Bacteria | 1321 |
| 108 | Ga0466715_496543 | 3300042616 | Bacteria | 1101 |
| 109 | Ga0466718_011900 | 3300042617 | Bacteria | 5115 |
| 110 | Ga0466723_303816 | 3300042618 | Bacteria | 2113 |
| 111 | Ga0466703_045474 | 3300042636 | Bacteria | 20826 |
| 112 | Ga0466703_219376 | 3300042636 | Bacteria | 9535 |
| 113 | Ga0466704_231866 | 3300042643 | Bacteria | 63702 |
| 114 | Ga0466704_325772 | 3300042643 | Bacteria | 1329 |
| 115 | Ga0466709_038656 | 3300042648 | Bacteria | 7883 |
| 116 | Ga0466709_187632 | 3300042648 | Bacteria | 2600 |
| 117 | Ga0466708_212693 | 3300042652 | Bacteria | 1815 |
| 118 | JGI24698J34947_10005832 | 3300002449 | Bacteria | 6751 |
| 119 | Ga0123357_10282464 | 3300009784 | Bacteria | 1712 |
| 120 | Ga0123353_10139937 | 3300010167 | Bacteria | 3877 |
| 121 | Ga0123353_10327686 | 3300010167 | Bacteria | 2320 |
| 122 | Ga0123353_10672287 | 3300010167 | Unclassified | 1460 |
| 123 | Ga0123354_10362337 | 3300010882 | Bacteria | 1276 |
| 124 | Ga0466690_007313 | 3300042590 | Bacteria | 1178 |
| 125 | Ga0466691_038249 | 3300042593 | Bacteria | 14774 |
| 126 | Ga0466694_320702 | 3300042594 | Bacteria | 1444 |
| 127 | Ga0466711_072232 | 3300042615 | Bacteria | 3241 |
| 128 | Ga0466715_024264 | 3300042616 | Bacteria | 10856 |
| 129 | Ga0466718_043261 | 3300042617 | Bacteria | 7822 |
| 130 | Ga0466723_116213 | 3300042618 | Bacteria | 10447 |
| 131 | Ga0466723_300095 | 3300042618 | Bacteria | 6320 |
| 132 | Ga0466723_320163 | 3300042618 | Bacteria | 6814 |
| 133 | Ga0466703_154140 | 3300042636 | Bacteria | 2812 |
| 134 | AustNasuHG_c1002874 | 3300000089 | Bacteria | 6220 |
| 135 | JGI24695J34938_10212083 | 3300002450 | Bacteria | 810 |
| 136 | Ga0123353_10469340 | 3300010167 | Bacteria | 1846 |
| 137 | Ga0123353_10567726 | 3300010167 | Bacteria | 1632 |
| 138 | Ga0466691_201297 | 3300042593 | Bacteria | 2623 |
| 139 | Ga0466696_270319 | 3300042596 | Bacteria | 5083 |
| 140 | Ga0466711_069215 | 3300042615 | Bacteria | 18178 |
| 141 | Ga0466728_025124 | 3300042620 | Bacteria | 1374 |
| 142 | Ga0466728_056166 | 3300042620 | Bacteria | 2483 |
| 143 | Ga0466703_110840 | 3300042636 | Bacteria | 29633 |
| 144 | Ga0466704_052934 | 3300042643 | Bacteria | 2212 |
| 145 | Ga0466704_134096 | 3300042643 | Bacteria | 11776 |
| 146 | Ga0466709_293763 | 3300042648 | Bacteria | 2340 |
| 147 | Ga0466709_355733 | 3300042648 | Bacteria | 7370 |
| 148 | Ga0466708_013698 | 3300042652 | Bacteria | 10814 |
| 149 | Ga0466708_176095 | 3300042652 | Bacteria | 8890 |
| 150 | Ga0466727_000057 | 3300042655 | Bacteria | 4353 |
| 151 | Ga0466727_315528 | 3300042655 | Bacteria | 1755 |
| 152 | JGI24702J35022_10366492 | 3300002462 | Bacteria | 864 |
| 153 | Ga0072941_1032093 | 3300005201 | Bacteria | 3538 |
| 154 | Ga0123357_10147161 | 3300009784 | Bacteria | 2872 |
| 155 | Ga0123355_10011062 | 3300009826 | Bacteria | 13891 |
| 156 | Ga0264413_115753 | 3300024493 | Bacteria | 6588 |
| 157 | Ga0466690_091134 | 3300042590 | Bacteria | 1283 |
| 158 | Ga0466690_207749 | 3300042590 | Bacteria | 1658 |
| 159 | Ga0466695_213713 | 3300042595 | Bacteria | 10555 |
| 160 | Ga0466728_029978 | 3300042620 | Bacteria | 6026 |
| 161 | Ga0466728_059637 | 3300042620 | Bacteria | 1872 |
| 162 | Ga0466703_238650 | 3300042636 | Bacteria | 16016 |
| 163 | Ga0466704_575112 | 3300042643 | Bacteria | 5105 |
| 164 | Ga0466709_360981 | 3300042648 | Bacteria | 1354 |
| 165 | Ga0466727_269719 | 3300042655 | Bacteria | 1070 |
| 166 | JGI24698J34947_10023576 | 3300002449 | Bacteria | 3292 |
| 167 | JGI24702J35022_10000912 | 3300002462 | Bacteria | 18394 |
| 168 | Ga0072940_1578187 | 3300005200 | Bacteria | 839 |
| 169 | Ga0072941_1126105 | 3300005201 | Bacteria | 2397 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.