Protein Family IF08057
Metagenome
Isolate
251
Members
52
Samples
246
Scaffolds
327.66
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_106379|Ga0466723_106379_305_1435
- Length
- 376 aa
- Sequence
- MVKQPNRILSIFQTPVNADLRFDEKCLGKNGPGPGFSSKSGLVFSKFNRLKMPLFMILFLFAGILSVSAVSDIGLRIRYFDKRIYYVQGDDEDPIFIHITITNTGSSTYRFKLADERAFSVDFDIRTMSNRTLDPSELLVRKRTANRQVFFREVVVEPGESFSFVEDLRNYAELNQAGSFIIQARMYPELYRPAPDGPAAGISAAYPLESNRLHLNLRPPSLSGPGGIPLAMDVETNAILVREQLPPDQVIEYILTARQKSQWEKFFLYMDLETMISRDSVRRRQWLAESEEGRQRMLARYRAELENGVIDGDIVTIPAEFQIERTTYGAEEGTVTVLEKFKIGNYTERKRYTYYLRRKDDIWTIIDYTVLNLGTE
Sample Types
Isolate
2.0%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.0%
Kalotermitidae
28.0%
Unclassified
16.0%
Rhinotermitidae
6.0%
Termopsidae
6.0%
Taxonomy
Archaea
1
Bacteria
236
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 33 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 46 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 47 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_025004 | 3300042616 | Bacteria | 13217 |
| 2 | Ga0466715_127378 | 3300042616 | Bacteria | 17260 |
| 3 | Ga0466715_214007 | 3300042616 | Bacteria | 6039 |
| 4 | Ga0466718_035678 | 3300042617 | Bacteria | 14749 |
| 5 | Ga0466723_106379 | 3300042618 | Bacteria | 1595 |
| 6 | Ga0466723_150950 | 3300042618 | Bacteria | 119524 |
| 7 | Ga0466723_344578 | 3300042618 | Bacteria | 12792 |
| 8 | Ga0466726_368730 | 3300042619 | Bacteria | 4763 |
| 9 | Ga0466701_046455 | 3300042598 | Bacteria | 1185 |
| 10 | Ga0466707_391410 | 3300042601 | Bacteria | 1770 |
| 11 | Ga0466722_207609 | 3300042609 | Bacteria | 1428 |
| 12 | Ga0466722_225698 | 3300042609 | Bacteria | 1696 |
| 13 | Ga0123354_10156956 | 3300010882 | Bacteria | 2724 |
| 14 | Ga0466692_117096 | 3300042591 | Bacteria | 9821 |
| 15 | Ga0466691_069533 | 3300042593 | Bacteria | 6766 |
| 16 | Ga0466691_089239 | 3300042593 | Bacteria | 12278 |
| 17 | Ga0466691_089496 | 3300042593 | Bacteria | 28725 |
| 18 | Ga0466691_097173 | 3300042593 | Bacteria | 17740 |
| 19 | Ga0466691_194184 | 3300042593 | Bacteria | 15293 |
| 20 | Ga0466699_090088 | 3300042597 | Unclassified | 2373 |
| 21 | JGI24698J34947_10050703 | 3300002449 | Unclassified | 2091 |
| 22 | JGI24698J34947_10051550 | 3300002449 | Bacteria | 2069 |
| 23 | JGI24698J34947_10065450 | 3300002449 | Unclassified | 1772 |
| 24 | JGI24695J34938_10009779 | 3300002450 | Bacteria | 5308 |
| 25 | JGI24702J35022_10030064 | 3300002462 | Bacteria | 2914 |
| 26 | Ga0074263_110269 | 3300005485 | Bacteria | 1592 |
| 27 | Ga0466703_069950 | 3300042636 | Bacteria | 6894 |
| 28 | Ga0466704_108038 | 3300042643 | Bacteria | 18603 |
| 29 | Ga0466708_096365 | 3300042652 | Bacteria | 19029 |
| 30 | Ga0466715_027084 | 3300042616 | Bacteria | 7490 |
| 31 | Ga0466715_032607 | 3300042616 | Bacteria | 5682 |
| 32 | Ga0466718_028704 | 3300042617 | Bacteria | 5897 |
| 33 | Ga0466718_047176 | 3300042617 | Bacteria | 24660 |
| 34 | Ga0466718_059861 | 3300042617 | Bacteria | 1925 |
| 35 | Ga0466723_124874 | 3300042618 | Bacteria | 7397 |
| 36 | Ga0466723_170091 | 3300042618 | Bacteria | 3359 |
| 37 | Ga0466723_216070 | 3300042618 | Bacteria | 7278 |
| 38 | Ga0466729_079589 | 3300042621 | Bacteria | 3834 |
| 39 | Ga0466705_070858 | 3300042612 | Bacteria | 3696 |
| 40 | Ga0466732_168989 | 3300042656 | Bacteria | 3018 |
| 41 | Ga0466707_227832 | 3300042601 | Bacteria | 1716 |
| 42 | Ga0466719_056173 | 3300042606 | Bacteria | 6793 |
| 43 | Ga0466719_140800 | 3300042606 | Bacteria | 7992 |
| 44 | Ga0466719_459331 | 3300042606 | Bacteria | 11143 |
| 45 | Ga0466722_000511 | 3300042609 | Bacteria | 9118 |
| 46 | Ga0466722_054182 | 3300042609 | Bacteria | 2191 |
| 47 | Ga0466722_068010 | 3300042609 | Bacteria | 2007 |
| 48 | Ga0466722_107027 | 3300042609 | Bacteria | 2796 |
| 49 | Ga0466722_197656 | 3300042609 | Bacteria | 3202 |
| 50 | Ga0466722_200604 | 3300042609 | Bacteria | 5305 |
| 51 | Ga0123357_10100990 | 3300009784 | Bacteria | 3719 |
| 52 | Ga0123356_10313542 | 3300010049 | Bacteria | 1679 |
| 53 | Ga0123353_10363788 | 3300010167 | Bacteria | 2172 |
| 54 | Ga0123354_10160254 | 3300010882 | Bacteria | 2675 |
| 55 | Ga0264413_125195 | 3300024493 | Bacteria | 3878 |
| 56 | Ga0264413_125444 | 3300024493 | Bacteria | 7425 |
| 57 | Ga0264413_132432 | 3300024493 | Bacteria | 1798 |
| 58 | Ga0466690_273457 | 3300042590 | Unclassified | 3387 |
| 59 | Ga0466699_329176 | 3300042597 | Bacteria | 10503 |
| 60 | Ga0466699_425951 | 3300042597 | Bacteria | 1154 |
| 61 | Ga0466735_100692 | 3300042624 | Bacteria | 8023 |
| 62 | Ga0466703_325863 | 3300042636 | Bacteria | 8217 |
| 63 | Ga0466704_259721 | 3300042643 | Bacteria | 3047 |
| 64 | Ga0466708_047441 | 3300042652 | Bacteria | 3003 |
| 65 | Ga0466708_096531 | 3300042652 | Bacteria | 1951 |
| 66 | Ga0466708_387034 | 3300042652 | Bacteria | 17567 |
| 67 | Ga0466705_459764 | 3300042612 | Bacteria | 3575 |
| 68 | Ga0466712_102455 | 3300042614 | Bacteria | 17618 |
| 69 | Ga0466711_011556 | 3300042615 | Bacteria | 5493 |
| 70 | Ga0466711_232794 | 3300042615 | Bacteria | 2929 |
| 71 | Ga0466715_192433 | 3300042616 | Bacteria | 2129 |
| 72 | Ga0466715_611952 | 3300042616 | Bacteria | 3480 |
| 73 | Ga0466718_046311 | 3300042617 | Bacteria | 10585 |
| 74 | Ga0466718_076456 | 3300042617 | Unclassified | 2269 |
| 75 | Ga0466718_128036 | 3300042617 | Bacteria | 29323 |
| 76 | Ga0466718_154767 | 3300042617 | Bacteria | 2526 |
| 77 | Ga0466726_464293 | 3300042619 | Bacteria | 3603 |
| 78 | Ga0466726_481725 | 3300042619 | Bacteria | 1780 |
| 79 | Ga0466728_119528 | 3300042620 | Bacteria | 22681 |
| 80 | Ga0466705_131799 | 3300042612 | Bacteria | 3271 |
| 81 | Ga0466705_134423 | 3300042612 | Bacteria | 4406 |
| 82 | Ga0466717_085171 | 3300042604 | Bacteria | 1556 |
| 83 | Ga0466719_108615 | 3300042606 | Bacteria | 4192 |
| 84 | Ga0466722_000120 | 3300042609 | Bacteria | 3665 |
| 85 | Ga0466722_022162 | 3300042609 | Bacteria | 15514 |
| 86 | Ga0466722_097331 | 3300042609 | Bacteria | 79624 |
| 87 | Ga0123353_10170979 | 3300010167 | Unclassified | 3450 |
| 88 | Ga0415639_092797 | 3300038395 | Bacteria | 3556 |
| 89 | Ga0466696_103562 | 3300042596 | Bacteria | 4192 |
| 90 | Ga0466696_435701 | 3300042596 | Bacteria | 8824 |
| 91 | Ga0466696_453232 | 3300042596 | Bacteria | 4674 |
| 92 | Ga0466699_062969 | 3300042597 | Bacteria | 4914 |
| 93 | Ga0466699_147011 | 3300042597 | Bacteria | 23668 |
| 94 | AustNasuHG_c1013033 | 3300000089 | Bacteria | 2859 |
| 95 | JGI24698J34947_10008345 | 3300002449 | Bacteria | 5683 |
| 96 | JGI24698J34947_10016481 | 3300002449 | Bacteria | 4011 |
| 97 | JGI24695J34938_10065276 | 3300002450 | Bacteria | 1538 |
| 98 | Ga0072940_1036836 | 3300005200 | Bacteria | 4906 |
| 99 | Ga0072941_1070887 | 3300005201 | Bacteria | 4289 |
| 100 | Ga0072941_1115775 | 3300005201 | Bacteria | 3688 |
| 101 | Ga0466703_207371 | 3300042636 | Bacteria | 2614 |
| 102 | Ga0466704_094394 | 3300042643 | Bacteria | 2785 |
| 103 | Ga0466704_094437 | 3300042643 | Bacteria | 3373 |
| 104 | Ga0466704_474733 | 3300042643 | Bacteria | 2901 |
| 105 | Ga0466709_284931 | 3300042648 | Bacteria | 7547 |
| 106 | Ga0466709_329262 | 3300042648 | Bacteria | 25457 |
| 107 | Ga0466708_040913 | 3300042652 | Bacteria | 8879 |
| 108 | Ga0466708_417541 | 3300042652 | Bacteria | 43144 |
| 109 | Ga0466723_008861 | 3300042618 | Bacteria | 2447 |
| 110 | Ga0466723_076933 | 3300042618 | Bacteria | 1207 |
| 111 | Ga0466726_042769 | 3300042619 | Bacteria | 28047 |
| 112 | Ga0466726_452828 | 3300042619 | Bacteria | 2288 |
| 113 | Ga0466728_472700 | 3300042620 | Bacteria | 7189 |
| 114 | Ga0466705_089294 | 3300042612 | Unclassified | 2572 |
| 115 | Ga0466705_183488 | 3300042612 | Bacteria | 2845 |
| 116 | Ga0466707_229663 | 3300042601 | Bacteria | 1643 |
| 117 | Ga0466713_009996 | 3300042602 | Unclassified | 2888 |
| 118 | Ga0466716_374332 | 3300042605 | Bacteria | 3862 |
| 119 | Ga0466720_101717 | 3300042607 | Unclassified | 1474 |
| 120 | Ga0466722_013751 | 3300042609 | Bacteria | 9854 |
| 121 | Ga0123357_10119154 | 3300009784 | Bacteria | 3332 |
| 122 | Ga0123353_10481699 | 3300010167 | Bacteria | 1815 |
| 123 | Ga0264413_102064 | 3300024493 | Bacteria | 14247 |
| 124 | Ga0466690_082971 | 3300042590 | Unclassified | 3652 |
| 125 | Ga0466690_394508 | 3300042590 | Bacteria | 2500 |
| 126 | Ga0466691_173255 | 3300042593 | Bacteria | 5360 |
| 127 | Ga0466691_192664 | 3300042593 | Bacteria | 1666 |
| 128 | Ga0466694_343617 | 3300042594 | Bacteria | 1054 |
| 129 | Ga0466696_023207 | 3300042596 | Bacteria | 24784 |
| 130 | Ga0466696_045538 | 3300042596 | Bacteria | 3962 |
| 131 | Ga0466696_334103 | 3300042596 | Bacteria | 3164 |
| 132 | AustNasuHG_c1001942 | 3300000089 | Bacteria | 7446 |
| 133 | JGI24698J34947_10026060 | 3300002449 | Unclassified | 3109 |
| 134 | JGI24700J35501_10929915 | 3300002508 | Bacteria | 10599 |
| 135 | Ga0466703_020216 | 3300042636 | Bacteria | 9558 |
| 136 | Ga0466709_236114 | 3300042648 | Bacteria | 5884 |
| 137 | Ga0466705_396788 | 3300042612 | Unclassified | 6231 |
| 138 | Ga0466711_038973 | 3300042615 | Bacteria | 29172 |
| 139 | Ga0466711_195513 | 3300042615 | Bacteria | 2296 |
| 140 | Ga0466715_238001 | 3300042616 | Bacteria | 1136 |
| 141 | Ga0466715_392548 | 3300042616 | Bacteria | 2220 |
| 142 | Ga0466718_060318 | 3300042617 | Bacteria | 11613 |
| 143 | Ga0466718_161530 | 3300042617 | Bacteria | 2421 |
| 144 | Ga0466726_032783 | 3300042619 | Bacteria | 2968 |
| 145 | Ga0466726_253581 | 3300042619 | Bacteria | 4774 |
| 146 | Ga0466726_418409 | 3300042619 | Bacteria | 1772 |
| 147 | Ga0466700_288582 | 3300042600 | Bacteria | 1830 |
| 148 | Ga0466716_307119 | 3300042605 | Bacteria | 5906 |
| 149 | Ga0466716_417680 | 3300042605 | Unclassified | 1749 |
| 150 | Ga0466719_317133 | 3300042606 | Bacteria | 71181 |
| 151 | Ga0466722_108537 | 3300042609 | Bacteria | 13976 |
| 152 | Ga0466690_180188 | 3300042590 | Bacteria | 1837 |
| 153 | Ga0466692_152537 | 3300042591 | Bacteria | 2605 |
| 154 | Ga0466691_080304 | 3300042593 | Bacteria | 14888 |
| 155 | Ga0466694_058928 | 3300042594 | Bacteria | 1670 |
| 156 | JGI24698J34947_10003063 | 3300002449 | Bacteria | 9049 |
| 157 | JGI24698J34947_10040898 | 3300002449 | Bacteria | 2391 |
| 158 | Ga0074263_108969 | 3300005485 | Bacteria | 1500 |
| 159 | Ga0074263_112943 | 3300005485 | Bacteria | 1866 |
| 160 | Ga0466703_097389 | 3300042636 | Bacteria | 65902 |
| 161 | Ga0466703_164357 | 3300042636 | Bacteria | 2949 |
| 162 | Ga0466703_265906 | 3300042636 | Bacteria | 1755 |
| 163 | Ga0466704_197889 | 3300042643 | Bacteria | 4373 |
| 164 | Ga0466704_548479 | 3300042643 | Bacteria | 4708 |
| 165 | Ga0466708_198988 | 3300042652 | Bacteria | 7953 |
| 166 | Ga0466708_467051 | 3300042652 | Bacteria | 2146 |
| 167 | Ga0466712_000948 | 3300042614 | Bacteria | 18945 |
| 168 | Ga0466711_301028 | 3300042615 | Bacteria | 8657 |
| 169 | Ga0466718_085627 | 3300042617 | Bacteria | 2236 |
| 170 | Ga0466723_047012 | 3300042618 | Bacteria | 39235 |
| 171 | Ga0466726_261070 | 3300042619 | Bacteria | 2336 |
| 172 | Ga0466726_446469 | 3300042619 | Bacteria | 7089 |
| 173 | Ga0466728_138314 | 3300042620 | Bacteria | 1512 |
| 174 | Ga0466716_083757 | 3300042605 | Bacteria | 17526 |
| 175 | Ga0466716_352671 | 3300042605 | Bacteria | 6365 |
| 176 | Ga0466719_328083 | 3300042606 | Bacteria | 3760 |
| 177 | Ga0466719_441363 | 3300042606 | Bacteria | 1956 |
| 178 | Ga0466722_075561 | 3300042609 | Bacteria | 3124 |
| 179 | Ga0466722_077171 | 3300042609 | Bacteria | 2110 |
| 180 | Ga0466694_093638 | 3300042594 | Bacteria | 10873 |
| 181 | Ga0466696_012727 | 3300042596 | Bacteria | 6837 |
| 182 | Ga0466696_142903 | 3300042596 | Bacteria | 3429 |
| 183 | AustNasuHG_c1009107 | 3300000089 | Bacteria | 3497 |
| 184 | JGI24698J34947_10012662 | 3300002449 | Bacteria | 4619 |
| 185 | Ga0074263_102006 | 3300005485 | Bacteria | 4430 |
| 186 | Ga0466703_012380 | 3300042636 | Bacteria | 5003 |
| 187 | Ga0466704_140988 | 3300042643 | Bacteria | 10220 |
| 188 | Ga0466704_220173 | 3300042643 | Bacteria | 31396 |
| 189 | Ga0466709_172904 | 3300042648 | Bacteria | 14335 |
| 190 | Ga0466709_242317 | 3300042648 | Bacteria | 10624 |
| 191 | Ga0466709_311433 | 3300042648 | Bacteria | 9687 |
| 192 | Ga0466727_243860 | 3300042655 | Bacteria | 15153 |
| 193 | Ga0466727_343266 | 3300042655 | Bacteria | 1267 |
| 194 | Ga0466712_178961 | 3300042614 | Bacteria | 1591 |
| 195 | Ga0466711_048633 | 3300042615 | Bacteria | 6673 |
| 196 | Ga0466715_551351 | 3300042616 | Bacteria | 2451 |
| 197 | Ga0466718_080731 | 3300042617 | Bacteria | 2454 |
| 198 | Ga0466723_168913 | 3300042618 | Bacteria | 1546 |
| 199 | Ga0466705_153285 | 3300042612 | Bacteria | 11777 |
| 200 | Ga0466705_204736 | 3300042612 | Bacteria | 18205 |
| 201 | Ga0466732_263473 | 3300042656 | Bacteria | 3109 |
| 202 | Ga0466732_394558 | 3300042656 | Bacteria | 3731 |
| 203 | Ga0466713_026187 | 3300042602 | Bacteria | 31074 |
| 204 | Ga0466717_191532 | 3300042604 | Bacteria | 2012 |
| 205 | Ga0466719_306213 | 3300042606 | Bacteria | 7800 |
| 206 | Ga0466722_209160 | 3300042609 | Bacteria | 8693 |
| 207 | Ga0123356_10143055 | 3300010049 | Bacteria | 2362 |
| 208 | Ga0264413_109900 | 3300024493 | Bacteria | 3064 |
| 209 | Ga0466690_353963 | 3300042590 | Unclassified | 8517 |
| 210 | Ga0466692_203440 | 3300042591 | Bacteria | 1878 |
| 211 | Ga0466694_031652 | 3300042594 | Bacteria | 2866 |
| 212 | Ga0466694_392882 | 3300042594 | Bacteria | 1446 |
| 213 | Ga0466696_269220 | 3300042596 | Bacteria | 4777 |
| 214 | Ga0466696_437825 | 3300042596 | Bacteria | 1834 |
| 215 | Ga0068305_10030337 | 3300005083 | Bacteria | 2562 |
| 216 | Ga0072940_1113769 | 3300005200 | Bacteria | 4106 |
| 217 | Ga0466731_306289 | 3300042622 | Bacteria | 2503 |
| 218 | Ga0466704_243966 | 3300042643 | Bacteria | 4497 |
| 219 | Ga0466708_020351 | 3300042652 | Bacteria | 35169 |
| 220 | Ga0466712_038930 | 3300042614 | Bacteria | 3553 |
| 221 | Ga0466711_341939 | 3300042615 | Bacteria | 29295 |
| 222 | Ga0466718_060812 | 3300042617 | Bacteria | 2899 |
| 223 | Ga0466718_092209 | 3300042617 | Bacteria | 73198 |
| 224 | Ga0466723_052961 | 3300042618 | Bacteria | 34600 |
| 225 | Ga0466726_035140 | 3300042619 | Bacteria | 13387 |
| 226 | Ga0466707_334574 | 3300042601 | Bacteria | 1035 |
| 227 | Ga0466717_066965 | 3300042604 | Bacteria | 2618 |
| 228 | Ga0466716_331501 | 3300042605 | Bacteria | 9506 |
| 229 | Ga0466720_049593 | 3300042607 | Bacteria | 16560 |
| 230 | Ga0466722_181926 | 3300042609 | Bacteria | 13941 |
| 231 | Ga0264413_105819 | 3300024493 | Bacteria | 4606 |
| 232 | Ga0415639_023937 | 3300038395 | Bacteria | 7316 |
| 233 | Ga0466690_068104 | 3300042590 | Bacteria | 7646 |
| 234 | Ga0466692_003646 | 3300042591 | Archaea | 12334 |
| 235 | Ga0466694_077871 | 3300042594 | Bacteria | 71235 |
| 236 | Ga0466699_233371 | 3300042597 | Bacteria | 3549 |
| 237 | Ga0466699_256223 | 3300042597 | Bacteria | 1950 |
| 238 | JGI24698J34947_10014171 | 3300002449 | Bacteria | 4341 |
| 239 | JGI24698J34947_10029122 | 3300002449 | Bacteria | 2920 |
| 240 | Ga0072941_1049278 | 3300005201 | Bacteria | 5089 |
| 241 | Ga0072941_1051249 | 3300005201 | Bacteria | 5439 |
| 242 | Ga0466703_046184 | 3300042636 | Bacteria | 8350 |
| 243 | Ga0466703_101873 | 3300042636 | Bacteria | 27649 |
| 244 | Ga0466709_119016 | 3300042648 | Bacteria | 7209 |
| 245 | Ga0466709_326882 | 3300042648 | Bacteria | 8594 |
| 246 | Ga0466708_137774 | 3300042652 | Bacteria | 20645 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.