Protein Family IF08006
Metagenome
Isolate
125
Members
38
Samples
123
Scaffolds
347.72
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_026659|Ga0466723_026659_12495_13700
- Length
- 401 aa
- Sequence
- LRFRDSHEHEKVSEALPLFHKTLDCIRGFLLPCNNLREVFMKPQNRTQGAMPRRLLACSLLLWLACIQGFGLGNKEEPTKGTGDPAFQRSIAVFIPGVMSGSPIYEMLAQGVKQAGAEKSTEERTVTVTVIEGGFNQAEWEGRITALAASGNYDLIVSSNPSLPAIAASVASKFPKQRFLLLDGKIEGNPQIYTLRYNQREQAYMAGHIAALVAGEGAPEGGPAVRIGLVAGQEYPAMNEVILPAYREGARQVDPQATVDFRVVGNWFDAGKGAELAADMIRGGAKVILSIAGSANEGVVQAAAEAGAKAVWFDINGYAVRPGTVVGSAVVYQDKAAYEQTLRFLEGTLPFGKAELLGVAEGYVDFIETDPHYRASVSAPIREKQGVLIGQIRSGALRLEE
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
32.4%
Unclassified
10.8%
Rhinotermitidae
8.1%
Termopsidae
8.1%
Blaberidae
2.7%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_013658 | 3300042659 | Bacteria | 32528 |
| 2 | Ga0466691_058612 | 3300042593 | Bacteria | 167737 |
| 3 | Ga0466691_167714 | 3300042593 | Bacteria | 14084 |
| 4 | Ga0466711_050170 | 3300042615 | Bacteria | 2866 |
| 5 | Ga0466711_512790 | 3300042615 | Bacteria | 5399 |
| 6 | Ga0466726_182834 | 3300042619 | Bacteria | 2808 |
| 7 | Ga0466726_404353 | 3300042619 | Bacteria | 1110 |
| 8 | Ga0466700_146900 | 3300042600 | Bacteria | 1345 |
| 9 | Ga0466722_185587 | 3300042609 | Bacteria | 2486 |
| 10 | Ga0123353_10768832 | 3300010167 | Bacteria | 1337 |
| 11 | Ga0466708_219670 | 3300042652 | Bacteria | 11638 |
| 12 | Ga0466732_105123 | 3300042656 | Bacteria | 2205 |
| 13 | Ga0466733_162788 | 3300042659 | Bacteria | 2213 |
| 14 | Ga0466733_167931 | 3300042659 | Bacteria | 9812 |
| 15 | JGI24698J34947_10012853 | 3300002449 | Bacteria | 4577 |
| 16 | Ga0466692_179287 | 3300042591 | Bacteria | 5909 |
| 17 | Ga0466691_060495 | 3300042593 | Bacteria | 5105 |
| 18 | Ga0466723_140183 | 3300042618 | Bacteria | 4681 |
| 19 | Ga0466726_155204 | 3300042619 | Bacteria | 1953 |
| 20 | Ga0466728_464196 | 3300042620 | Bacteria | 2967 |
| 21 | Ga0466716_166132 | 3300042605 | Bacteria | 7578 |
| 22 | Ga0466716_444536 | 3300042605 | Bacteria | 7069 |
| 23 | Ga0466719_144176 | 3300042606 | Bacteria | 32253 |
| 24 | Ga0466719_441814 | 3300042606 | Bacteria | 1889 |
| 25 | Ga0466704_068206 | 3300042643 | Bacteria | 27005 |
| 26 | Ga0466709_416967 | 3300042648 | Bacteria | 6450 |
| 27 | Ga0466708_014218 | 3300042652 | Bacteria | 9345 |
| 28 | Ga0466705_074997 | 3300042612 | Bacteria | 2053 |
| 29 | Ga0466733_087393 | 3300042659 | Bacteria | 4430 |
| 30 | Ga0466690_213299 | 3300042590 | Bacteria | 1542 |
| 31 | Ga0466692_040036 | 3300042591 | Bacteria | 2052 |
| 32 | Ga0466715_105274 | 3300042616 | Bacteria | 35913 |
| 33 | Ga0466728_040673 | 3300042620 | Bacteria | 22869 |
| 34 | Ga0466701_089483 | 3300042598 | Bacteria | 1317 |
| 35 | Ga0466719_045356 | 3300042606 | Bacteria | 2189 |
| 36 | Ga0466719_209401 | 3300042606 | Bacteria | 9384 |
| 37 | Ga0466698_114643 | 3300042610 | Bacteria | 1423 |
| 38 | Ga0466735_155112 | 3300042624 | Bacteria | 2744 |
| 39 | Ga0466704_095845 | 3300042643 | Bacteria | 89284 |
| 40 | Ga0466709_248107 | 3300042648 | Bacteria | 14856 |
| 41 | Ga0466709_354862 | 3300042648 | Bacteria | 8431 |
| 42 | Ga0466690_126417 | 3300042590 | Bacteria | 3393 |
| 43 | Ga0466691_199179 | 3300042593 | Bacteria | 10697 |
| 44 | Ga0466694_217378 | 3300042594 | Bacteria | 2578 |
| 45 | Ga0466694_234888 | 3300042594 | Bacteria | 1224 |
| 46 | Ga0466694_266458 | 3300042594 | Bacteria | 10083 |
| 47 | Ga0466712_039278 | 3300042614 | Bacteria | 5621 |
| 48 | Ga0466715_057946 | 3300042616 | Bacteria | 8578 |
| 49 | Ga0466718_042151 | 3300042617 | Bacteria | 2446 |
| 50 | Ga0466723_064290 | 3300042618 | Bacteria | 18329 |
| 51 | Ga0466728_448871 | 3300042620 | Bacteria | 1343 |
| 52 | Ga0466713_105632 | 3300042602 | Bacteria | 6949 |
| 53 | Ga0466722_030437 | 3300042609 | Bacteria | 5972 |
| 54 | Ga0466722_093627 | 3300042609 | Bacteria | 4873 |
| 55 | Ga0466722_166903 | 3300042609 | Bacteria | 7862 |
| 56 | Ga0123353_10255026 | 3300010167 | Bacteria | 2713 |
| 57 | Ga0466703_030252 | 3300042636 | Bacteria | 46951 |
| 58 | Ga0466703_270813 | 3300042636 | Bacteria | 5835 |
| 59 | Ga0466709_268129 | 3300042648 | Bacteria | 1286 |
| 60 | Ga0466709_380709 | 3300042648 | Bacteria | 2689 |
| 61 | Ga0068305_10015024 | 3300005083 | Bacteria | 2700 |
| 62 | Ga0456237_0001776 | 3300041968 | Bacteria | 3475 |
| 63 | Ga0466691_056401 | 3300042593 | Bacteria | 10069 |
| 64 | Ga0466691_104510 | 3300042593 | Bacteria | 5371 |
| 65 | Ga0466705_483465 | 3300042612 | Bacteria | 7838 |
| 66 | Ga0466723_041127 | 3300042618 | Bacteria | 26781 |
| 67 | Ga0466716_088790 | 3300042605 | Bacteria | 15243 |
| 68 | Ga0466719_205238 | 3300042606 | Bacteria | 4966 |
| 69 | Ga0466719_369676 | 3300042606 | Bacteria | 5138 |
| 70 | Ga0466722_205018 | 3300042609 | Bacteria | 7264 |
| 71 | Ga0466731_153785 | 3300042622 | Bacteria | 1517 |
| 72 | Ga0466703_300653 | 3300042636 | Bacteria | 10877 |
| 73 | Ga0466704_319580 | 3300042643 | Bacteria | 16194 |
| 74 | JGI24698J34947_10003547 | 3300002449 | Bacteria | 8472 |
| 75 | Ga0072941_1004616 | 3300005201 | Bacteria | 18977 |
| 76 | Ga0466692_123665 | 3300042591 | Bacteria | 13247 |
| 77 | Ga0466691_224847 | 3300042593 | Bacteria | 4302 |
| 78 | Ga0466715_010031 | 3300042616 | Bacteria | 13524 |
| 79 | Ga0466726_041847 | 3300042619 | Bacteria | 4010 |
| 80 | Ga0466726_129985 | 3300042619 | Bacteria | 11594 |
| 81 | Ga0466726_267845 | 3300042619 | Unclassified | 5316 |
| 82 | Ga0466726_367837 | 3300042619 | Bacteria | 1277 |
| 83 | Ga0466716_283272 | 3300042605 | Bacteria | 3743 |
| 84 | Ga0466719_002263 | 3300042606 | Bacteria | 5670 |
| 85 | Ga0466719_432905 | 3300042606 | Bacteria | 1905 |
| 86 | Ga0123357_10157882 | 3300009784 | Bacteria | 2729 |
| 87 | Ga0466731_236417 | 3300042622 | Bacteria | 1174 |
| 88 | Ga0466704_496283 | 3300042643 | Bacteria | 1968 |
| 89 | Ga0466705_223469 | 3300042612 | Bacteria | 3319 |
| 90 | Ga0466733_037501 | 3300042659 | Bacteria | 1983 |
| 91 | Ga0466696_151288 | 3300042596 | Bacteria | 6764 |
| 92 | Ga0466696_258149 | 3300042596 | Bacteria | 13063 |
| 93 | Ga0466712_020147 | 3300042614 | Bacteria | 1633 |
| 94 | Ga0466712_181350 | 3300042614 | Bacteria | 4777 |
| 95 | Ga0466711_250165 | 3300042615 | Bacteria | 77191 |
| 96 | Ga0466711_270444 | 3300042615 | Bacteria | 11279 |
| 97 | Ga0466715_097861 | 3300042616 | Bacteria | 28870 |
| 98 | Ga0466715_420933 | 3300042616 | Bacteria | 11310 |
| 99 | Ga0466715_608878 | 3300042616 | Bacteria | 2141 |
| 100 | Ga0466723_026659 | 3300042618 | Bacteria | 21026 |
| 101 | Ga0466726_438975 | 3300042619 | Bacteria | 2982 |
| 102 | Ga0466707_419580 | 3300042601 | Bacteria | 2434 |
| 103 | Ga0466716_108459 | 3300042605 | Bacteria | 7583 |
| 104 | Ga0466722_094639 | 3300042609 | Bacteria | 1250 |
| 105 | Ga0123353_10011696 | 3300010167 | Bacteria | 12385 |
| 106 | Ga0123353_10105352 | 3300010167 | Bacteria | 4545 |
| 107 | Ga0466709_310184 | 3300042648 | Bacteria | 21422 |
| 108 | Ga0466708_184808 | 3300042652 | Bacteria | 4791 |
| 109 | Ga0466733_074409 | 3300042659 | Bacteria | 4621 |
| 110 | Ga0466690_031567 | 3300042590 | Bacteria | 39446 |
| 111 | Ga0466715_077254 | 3300042616 | Bacteria | 24143 |
| 112 | Ga0466715_242547 | 3300042616 | Bacteria | 5490 |
| 113 | Ga0466726_057171 | 3300042619 | Bacteria | 4837 |
| 114 | Ga0466726_293711 | 3300042619 | Bacteria | 14655 |
| 115 | Ga0466700_254940 | 3300042600 | Bacteria | 2307 |
| 116 | Ga0466716_208534 | 3300042605 | Bacteria | 2274 |
| 117 | Ga0466719_338106 | 3300042606 | Bacteria | 21984 |
| 118 | Ga0466735_204143 | 3300042624 | Bacteria | 7310 |
| 119 | Ga0466703_078874 | 3300042636 | Bacteria | 4029 |
| 120 | Ga0466704_032513 | 3300042643 | Bacteria | 4718 |
| 121 | Ga0466708_111835 | 3300042652 | Bacteria | 4376 |
| 122 | Ga0466727_118925 | 3300042655 | Bacteria | 7351 |
| 123 | Ga0466727_305252 | 3300042655 | Bacteria | 1579 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02608 | Bmp | ABC transporter substrate-binding protein PnrA-like | 90 | 394 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02608 | GO:0005886 | plasma membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.