Protein Family IF08005
Metagenome
Isolate
177
Members
51
Samples
166
Scaffolds
518.29
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_026529|Ga0466723_026529_3810_5741
- Length
- 616 aa
- Sequence
- MEFKDLNLHPDLQRGIAEAGYVTCMPVQEQVLVNAFNGQDLYVQSQTGTGKTAAFLVVIFQRLLTEDLLGGKKAIIMVPTRELAVQVEEEAKSLGKYLPFKIGSFYGGVGYTQQVQTLRENAQILVGTPGRVLDLNKSGRMNLMDIAFLVLDEADRMFDMGFYPDLRKLIRVVPPADRRQTMLFSATLNAWVKNLAWEYTKNPFEIEIEPETVTVDEVDQFLYHVPSEDKMRLLLGILAREKPESAIIFCNTKRYTEIVAKRLRMNGYECEFIIGDLPQSRRLKIIDDVKAGNIRYLVATDVAARGLDIEGLAMVLNYDLPVESENYVHRIGRTARAGKTGKAITLASEQDVYELPDIEKYIGKKIPALIAGEELYAEDKSAGLRIHTEFAGNGLFGKRDGPGRFGRXXRDRRGSHKEGDVGFQGRDKAKRDDRRSGRRGEGTSLRDQTRQFEEAERARTDAGPGGSEDLSKLSFEQRMTYYRQKYKGQANSPQAPDQRPEGGRXXXTQAATAKREGPRRGEAQGKGQNIPKAAGGSTRGAANTSQPGGDKPPQSRPRNGKTAGHRRGPRGNQAGTRDRGVVNSAPAGGAATGKGPAAGPRKGVLGKLLSIFKRKE
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.8%
Kalotermitidae
26.5%
Unclassified
24.5%
Termopsidae
6.1%
Rhinotermitidae
4.1%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 28 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 35 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 36 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 48 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 49 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10022827 | 3300010049 | Bacteria | 5901 |
| 2 | Ga0415639_063362 | 3300038395 | Bacteria | 4566 |
| 3 | Ga0466691_049012 | 3300042593 | Bacteria | 72676 |
| 4 | Ga0466694_210281 | 3300042594 | Bacteria | 3360 |
| 5 | JGI24698J34947_10026511 | 3300002449 | Bacteria | 3079 |
| 6 | Ga0466711_156962 | 3300042615 | Bacteria | 18270 |
| 7 | Ga0466711_281841 | 3300042615 | Bacteria | 9038 |
| 8 | Ga0466711_366268 | 3300042615 | Bacteria | 22616 |
| 9 | Ga0466715_035432 | 3300042616 | Bacteria | 13494 |
| 10 | Ga0466719_352327 | 3300042606 | Bacteria | 10581 |
| 11 | Ga0466720_140025 | 3300042607 | Bacteria | 2784 |
| 12 | Ga0466720_193860 | 3300042607 | Bacteria | 10032 |
| 13 | Ga0466709_128803 | 3300042648 | Bacteria | 6000 |
| 14 | Ga0466709_298156 | 3300042648 | Bacteria | 51626 |
| 15 | Ga0466708_108618 | 3300042652 | Bacteria | 24572 |
| 16 | Ga0466705_366786 | 3300042612 | Bacteria | 3371 |
| 17 | Ga0123355_10097594 | 3300009826 | Bacteria | 4637 |
| 18 | Ga0264413_103165 | 3300024493 | Bacteria | 22797 |
| 19 | Ga0415639_032884 | 3300038395 | Bacteria | 5215 |
| 20 | Ga0466699_111103 | 3300042597 | Bacteria | 5314 |
| 21 | JGI24698J34947_10001446 | 3300002449 | Bacteria | 12490 |
| 22 | JGI24698J34947_10014817 | 3300002449 | Bacteria | 4246 |
| 23 | JGI24695J34938_10002136 | 3300002450 | Bacteria | 15441 |
| 24 | Ga0466705_471829 | 3300042612 | Bacteria | 51531 |
| 25 | Ga0466712_029234 | 3300042614 | Bacteria | 4634 |
| 26 | Ga0466711_113905 | 3300042615 | Unclassified | 15099 |
| 27 | Ga0466711_316434 | 3300042615 | Bacteria | 2438 |
| 28 | Ga0466715_420911 | 3300042616 | Bacteria | 4753 |
| 29 | Ga0466718_029696 | 3300042617 | Bacteria | 9410 |
| 30 | Ga0466718_056981 | 3300042617 | Bacteria | 24369 |
| 31 | Ga0466718_085517 | 3300042617 | Bacteria | 6935 |
| 32 | Ga0466726_375780 | 3300042619 | Bacteria | 12702 |
| 33 | Ga0466716_525209 | 3300042605 | Bacteria | 4422 |
| 34 | Ga0466719_050778 | 3300042606 | Bacteria | 24110 |
| 35 | Ga0466719_291325 | 3300042606 | Bacteria | 6098 |
| 36 | Ga0466719_303954 | 3300042606 | Bacteria | 16248 |
| 37 | Ga0466722_092184 | 3300042609 | Bacteria | 18368 |
| 38 | Ga0466722_188107 | 3300042609 | Bacteria | 10144 |
| 39 | Ga0466735_093428 | 3300042624 | Bacteria | 5183 |
| 40 | Ga0466704_273989 | 3300042643 | Bacteria | 40108 |
| 41 | Ga0466704_617953 | 3300042643 | Bacteria | 25933 |
| 42 | Ga0466727_278985 | 3300042655 | Bacteria | 39263 |
| 43 | Ga0123357_10056547 | 3300009784 | Bacteria | 5276 |
| 44 | JGI24698J34947_10001173 | 3300002449 | Bacteria | 13657 |
| 45 | JGI24698J34947_10011026 | 3300002449 | Bacteria | 4959 |
| 46 | JGI24695J34938_10000189 | 3300002450 | Bacteria | 57805 |
| 47 | JGI24695J34938_10000333 | 3300002450 | Bacteria | 46505 |
| 48 | Ga0123357_10003698 | 3300009784 | Bacteria | 17661 |
| 49 | Ga0466711_268092 | 3300042615 | Bacteria | 4719 |
| 50 | Ga0466718_105204 | 3300042617 | Bacteria | 13922 |
| 51 | Ga0466723_313713 | 3300042618 | Bacteria | 1942 |
| 52 | Ga0466726_042732 | 3300042619 | Bacteria | 4083 |
| 53 | Ga0466720_001847 | 3300042607 | Bacteria | 14739 |
| 54 | Ga0466720_125179 | 3300042607 | Bacteria | 9567 |
| 55 | Ga0466703_165891 | 3300042636 | Bacteria | 3379 |
| 56 | Ga0466703_407413 | 3300042636 | Bacteria | 8263 |
| 57 | Ga0466708_076715 | 3300042652 | Bacteria | 7230 |
| 58 | Ga0264413_100465 | 3300024493 | Bacteria | 11103 |
| 59 | Ga0264413_101444 | 3300024493 | Bacteria | 11493 |
| 60 | Ga0466692_011558 | 3300042591 | Bacteria | 17707 |
| 61 | Ga0466692_043438 | 3300042591 | Bacteria | 7036 |
| 62 | Ga0466692_194316 | 3300042591 | Bacteria | 15300 |
| 63 | Ga0466694_050139 | 3300042594 | Bacteria | 4203 |
| 64 | Ga0466699_209712 | 3300042597 | Bacteria | 12420 |
| 65 | Ga0466699_432863 | 3300042597 | Bacteria | 9292 |
| 66 | JGI24698J34947_10005277 | 3300002449 | Bacteria | 7088 |
| 67 | JGI24695J34938_10038901 | 3300002450 | Bacteria | 2152 |
| 68 | Ga0072941_1015756 | 3300005201 | Bacteria | 11022 |
| 69 | Ga0466712_231445 | 3300042614 | Bacteria | 33470 |
| 70 | Ga0466711_183350 | 3300042615 | Bacteria | 47393 |
| 71 | Ga0466718_109827 | 3300042617 | Bacteria | 3183 |
| 72 | Ga0466723_025018 | 3300042618 | Bacteria | 6454 |
| 73 | Ga0466716_090361 | 3300042605 | Bacteria | 12811 |
| 74 | Ga0466720_055547 | 3300042607 | Bacteria | 8449 |
| 75 | Ga0466698_277941 | 3300042610 | Bacteria | 2483 |
| 76 | Ga0466702_219284 | 3300042635 | Bacteria | 8528 |
| 77 | Ga0466704_125562 | 3300042643 | Bacteria | 4335 |
| 78 | Ga0466704_142165 | 3300042643 | Bacteria | 2595 |
| 79 | Ga0466709_077444 | 3300042648 | Bacteria | 3609 |
| 80 | Ga0466705_273356 | 3300042612 | Bacteria | 6378 |
| 81 | Ga0466705_288417 | 3300042612 | Bacteria | 14872 |
| 82 | Ga0466732_195138 | 3300042656 | Bacteria | 15041 |
| 83 | Ga0264413_102791 | 3300024493 | Bacteria | 17334 |
| 84 | Ga0466690_250526 | 3300042590 | Bacteria | 12530 |
| 85 | Ga0466692_091572 | 3300042591 | Bacteria | 8424 |
| 86 | Ga0466692_193290 | 3300042591 | Bacteria | 2775 |
| 87 | Ga0466699_195228 | 3300042597 | Bacteria | 2701 |
| 88 | Ga0466712_042559 | 3300042614 | Bacteria | 14554 |
| 89 | Ga0466715_145482 | 3300042616 | Bacteria | 10093 |
| 90 | Ga0466723_026529 | 3300042618 | Bacteria | 10863 |
| 91 | Ga0466723_194380 | 3300042618 | Bacteria | 46497 |
| 92 | Ga0466713_044716 | 3300042602 | Bacteria | 26822 |
| 93 | Ga0466716_323784 | 3300042605 | Bacteria | 2226 |
| 94 | Ga0466720_073511 | 3300042607 | Bacteria | 2685 |
| 95 | Ga0466722_039296 | 3300042609 | Bacteria | 4392 |
| 96 | Ga0466698_040123 | 3300042610 | Bacteria | 2976 |
| 97 | Ga0466698_069745 | 3300042610 | Bacteria | 4281 |
| 98 | Ga0466731_288764 | 3300042622 | Bacteria | 3941 |
| 99 | Ga0466703_017685 | 3300042636 | Bacteria | 10713 |
| 100 | Ga0466704_019642 | 3300042643 | Bacteria | 2815 |
| 101 | Ga0466704_172020 | 3300042643 | Bacteria | 7723 |
| 102 | Ga0466704_324800 | 3300042643 | Bacteria | 6603 |
| 103 | Ga0466708_080134 | 3300042652 | Bacteria | 5494 |
| 104 | Ga0466727_341155 | 3300042655 | Bacteria | 6673 |
| 105 | Ga0123356_10055281 | 3300010049 | Bacteria | 3697 |
| 106 | Ga0466692_061217 | 3300042591 | Bacteria | 34862 |
| 107 | Ga0466691_002029 | 3300042593 | Bacteria | 4983 |
| 108 | Ga0466696_048632 | 3300042596 | Bacteria | 38305 |
| 109 | Ga0466696_053658 | 3300042596 | Bacteria | 11965 |
| 110 | 2230954209 | 2228664003 | Bacteria | 14499 |
| 111 | JGI24698J34947_10024968 | 3300002449 | Unclassified | 3184 |
| 112 | JGI24695J34938_10002682 | 3300002450 | Bacteria | 13260 |
| 113 | Ga0466712_177249 | 3300042614 | Unclassified | 2647 |
| 114 | Ga0466715_139407 | 3300042616 | Bacteria | 2975 |
| 115 | Ga0466715_333792 | 3300042616 | Bacteria | 30394 |
| 116 | Ga0466723_029299 | 3300042618 | Bacteria | 122062 |
| 117 | Ga0466723_133486 | 3300042618 | Bacteria | 7154 |
| 118 | Ga0466716_030913 | 3300042605 | Bacteria | 22205 |
| 119 | Ga0466716_203278 | 3300042605 | Bacteria | 16353 |
| 120 | Ga0466722_060233 | 3300042609 | Bacteria | 17242 |
| 121 | Ga0466722_060470 | 3300042609 | Bacteria | 8732 |
| 122 | Ga0466703_042586 | 3300042636 | Bacteria | 7375 |
| 123 | Ga0466703_080000 | 3300042636 | Bacteria | 2465 |
| 124 | Ga0466703_333897 | 3300042636 | Bacteria | 14025 |
| 125 | Ga0466704_224514 | 3300042643 | Bacteria | 59923 |
| 126 | Ga0466732_209059 | 3300042656 | Bacteria | 8817 |
| 127 | Ga0466692_188450 | 3300042591 | Bacteria | 17267 |
| 128 | Ga0466691_141615 | 3300042593 | Bacteria | 5860 |
| 129 | Ga0466696_379415 | 3300042596 | Bacteria | 10883 |
| 130 | JGI24698J34947_10033306 | 3300002449 | Bacteria | 2704 |
| 131 | Ga0072941_1027978 | 3300005201 | Bacteria | 2734 |
| 132 | Ga0072941_1027979 | 3300005201 | Bacteria | 2204 |
| 133 | Ga0466712_166861 | 3300042614 | Bacteria | 2956 |
| 134 | Ga0466715_248577 | 3300042616 | Bacteria | 7324 |
| 135 | Ga0466718_006129 | 3300042617 | Bacteria | 2290 |
| 136 | Ga0466723_230994 | 3300042618 | Bacteria | 5837 |
| 137 | Ga0466723_264916 | 3300042618 | Bacteria | 8888 |
| 138 | Ga0466726_132862 | 3300042619 | Bacteria | 10282 |
| 139 | Ga0466716_403322 | 3300042605 | Bacteria | 5407 |
| 140 | Ga0466719_002706 | 3300042606 | Bacteria | 2710 |
| 141 | Ga0466720_039372 | 3300042607 | Bacteria | 5627 |
| 142 | Ga0466722_176099 | 3300042609 | Bacteria | 6411 |
| 143 | Ga0466703_069425 | 3300042636 | Bacteria | 4256 |
| 144 | Ga0466703_416525 | 3300042636 | Bacteria | 8574 |
| 145 | Ga0466704_133923 | 3300042643 | Bacteria | 6724 |
| 146 | Ga0466704_156411 | 3300042643 | Bacteria | 9243 |
| 147 | Ga0466704_389208 | 3300042643 | Bacteria | 2271 |
| 148 | Ga0466709_336219 | 3300042648 | Bacteria | 9389 |
| 149 | Ga0466708_338235 | 3300042652 | Bacteria | 21831 |
| 150 | Ga0466727_175486 | 3300042655 | Bacteria | 6488 |
| 151 | Ga0466733_016718 | 3300042659 | Bacteria | 7186 |
| 152 | Ga0123353_10118947 | 3300010167 | Bacteria | 4249 |
| 153 | Ga0466694_391068 | 3300042594 | Bacteria | 9941 |
| 154 | Ga0466696_237010 | 3300042596 | Bacteria | 4697 |
| 155 | AustNasuHG_c1005671 | 3300000089 | Bacteria | 4467 |
| 156 | JGI24695J34938_10000152 | 3300002450 | Bacteria | 63361 |
| 157 | Ga0466712_032761 | 3300042614 | Bacteria | 11278 |
| 158 | Ga0466712_077040 | 3300042614 | Bacteria | 9809 |
| 159 | Ga0466712_096206 | 3300042614 | Bacteria | 4320 |
| 160 | Ga0466712_161897 | 3300042614 | Bacteria | 14338 |
| 161 | Ga0466723_015550 | 3300042618 | Bacteria | 4625 |
| 162 | Ga0466720_020503 | 3300042607 | Bacteria | 7200 |
| 163 | Ga0466720_227994 | 3300042607 | Bacteria | 5946 |
| 164 | Ga0466722_024450 | 3300042609 | Bacteria | 3875 |
| 165 | Ga0466722_044174 | 3300042609 | Bacteria | 17572 |
| 166 | Ga0466703_322661 | 3300042636 | Bacteria | 48355 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.