Protein Family IF08002
Metagenome
Isolate
210
Members
59
Samples
195
Scaffolds
383.34
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_023976|Ga0466723_023976_8783_10045
- Length
- 420 aa
- Sequence
- MSDSGAPKSSIGNLIKNNIRNYSMFIMLAVIMVIFAFLTRGTNFNSRNFTNIFIQYSYVLILAVGMVQVIIIGGIDLSVGSVCAFVGAISVMVYNTGIGIIPTLLVALIIGAAIGAFQGFWIAYLQIPAFIVTLAGMLLFRGLTYIITKVNPINPHDDVYKQMASGFLNFPGLEIHYGGPIEGLRFGALPQELAGNFSIGTVYLSALLIGVIVAVLYIVTEIISRKNRLRNNFEVTPTPLFVGKVALISALVLFLSQRFSTYRGLPIVVIVLGVTIFIFNFIMKNTVLGRYIYAVGGNSRSAKLSGINSEQVVFIVFSIMGLLSGLAAVVSTGYMNSALPQAGNLFEMDAIAACYIGGVSASGGIGTVVGVIVGGLVMSAINNGMSLMNLGQHWQYVVKAAVVILAVLYDVYTRRKAGLG
Sample Types
Isolate
7.1%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.6%
Unclassified
24.6%
Kalotermitidae
24.6%
Rhinotermitidae
5.3%
Termopsidae
5.3%
Blaberidae
1.8%
Taxonomy
Archaea
0
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 26 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 43 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 44 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 45 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 46 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 49 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 50 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 55 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 56 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_100076 | 3300024493 | Bacteria | 24181 |
| 2 | Ga0466690_015904 | 3300042590 | Unclassified | 5784 |
| 3 | Ga0466692_043965 | 3300042591 | Unclassified | 19188 |
| 4 | Ga0466691_217385 | 3300042593 | Bacteria | 8931 |
| 5 | AustNasuHG_c1011582 | 3300000089 | Bacteria | 3055 |
| 6 | JGI24695J34938_10000633 | 3300002450 | Bacteria | 33528 |
| 7 | JGI24695J34938_10001271 | 3300002450 | Bacteria | 22126 |
| 8 | JGI24695J34938_10001743 | 3300002450 | Bacteria | 17993 |
| 9 | JGI24695J34938_10003164 | 3300002450 | Bacteria | 11705 |
| 10 | JGI24695J34938_10005942 | 3300002450 | Bacteria | 7473 |
| 11 | Ga0072940_1013799 | 3300005200 | Bacteria | 2361 |
| 12 | Ga0466711_033997 | 3300042615 | Bacteria | 50799 |
| 13 | Ga0466711_428232 | 3300042615 | Bacteria | 12559 |
| 14 | Ga0466715_363355 | 3300042616 | Bacteria | 5618 |
| 15 | Ga0466718_026948 | 3300042617 | Bacteria | 7467 |
| 16 | Ga0466726_034874 | 3300042619 | Bacteria | 3950 |
| 17 | Ga0466726_049108 | 3300042619 | Bacteria | 43705 |
| 18 | Ga0466726_355321 | 3300042619 | Bacteria | 4221 |
| 19 | Ga0466702_112803 | 3300042635 | Bacteria | 14797 |
| 20 | Ga0466703_145573 | 3300042636 | Bacteria | 9642 |
| 21 | Ga0466704_017421 | 3300042643 | Bacteria | 7657 |
| 22 | Ga0466720_067383 | 3300042607 | Bacteria | 28439 |
| 23 | Ga0466720_067539 | 3300042607 | Bacteria | 32042 |
| 24 | Ga0123356_10104675 | 3300010049 | Bacteria | 2721 |
| 25 | Ga0123353_10182608 | 3300010167 | Bacteria | 3319 |
| 26 | Ga0466705_178158 | 3300042612 | Bacteria | 4877 |
| 27 | Ga0466690_070876 | 3300042590 | Bacteria | 3259 |
| 28 | Ga0466696_192598 | 3300042596 | Bacteria | 32112 |
| 29 | Ga0466696_491409 | 3300042596 | Bacteria | 8739 |
| 30 | Ga0466699_043442 | 3300042597 | Bacteria | 8955 |
| 31 | AustNasuHG_c1016524 | 3300000089 | Bacteria | 2469 |
| 32 | AustNasuHG_c1020649 | 3300000089 | Bacteria | 2142 |
| 33 | AustNasuHG_c1025294 | 3300000089 | Bacteria | 1866 |
| 34 | JGI24698J34947_10003991 | 3300002449 | Bacteria | 8028 |
| 35 | JGI24695J34938_10000083 | 3300002450 | Bacteria | 81347 |
| 36 | JGI24702J35022_10016095 | 3300002462 | Bacteria | 4106 |
| 37 | Ga0466711_231064 | 3300042615 | Bacteria | 6764 |
| 38 | Ga0466718_032597 | 3300042617 | Bacteria | 11747 |
| 39 | Ga0466718_035945 | 3300042617 | Bacteria | 10291 |
| 40 | Ga0466723_078763 | 3300042618 | Bacteria | 34371 |
| 41 | Ga0466723_206850 | 3300042618 | Bacteria | 10211 |
| 42 | Ga0466726_024892 | 3300042619 | Bacteria | 7975 |
| 43 | Ga0466726_330965 | 3300042619 | Bacteria | 1644 |
| 44 | Ga0466728_107607 | 3300042620 | Bacteria | 4059 |
| 45 | Ga0466728_176296 | 3300042620 | Bacteria | 5491 |
| 46 | Ga0466702_265266 | 3300042635 | Bacteria | 1908 |
| 47 | Ga0466703_273161 | 3300042636 | Bacteria | 25534 |
| 48 | Ga0466708_338472 | 3300042652 | Bacteria | 22312 |
| 49 | Ga0466716_267588 | 3300042605 | Bacteria | 23240 |
| 50 | Ga0466720_116513 | 3300042607 | Bacteria | 3916 |
| 51 | Ga0466705_249703 | 3300042612 | Bacteria | 2565 |
| 52 | Ga0466732_317894 | 3300042656 | Bacteria | 3783 |
| 53 | Ga0466694_051267 | 3300042594 | Bacteria | 1771 |
| 54 | Ga0466694_363511 | 3300042594 | Bacteria | 12599 |
| 55 | Ga0466696_053288 | 3300042596 | Bacteria | 21014 |
| 56 | Ga0466699_071821 | 3300042597 | Bacteria | 9185 |
| 57 | Ga0466699_154994 | 3300042597 | Bacteria | 10048 |
| 58 | JGI24702J35022_10000405 | 3300002462 | Bacteria | 25725 |
| 59 | Ga0072941_1009078 | 3300005201 | Bacteria | 22637 |
| 60 | Ga0466718_107921 | 3300042617 | Bacteria | 23746 |
| 61 | Ga0466726_493850 | 3300042619 | Bacteria | 5575 |
| 62 | Ga0466728_029450 | 3300042620 | Bacteria | 3535 |
| 63 | Ga0466708_261397 | 3300042652 | Bacteria | 1525 |
| 64 | Ga0466727_040208 | 3300042655 | Bacteria | 4244 |
| 65 | Ga0466717_037086 | 3300042604 | Bacteria | 2015 |
| 66 | Ga0466719_079961 | 3300042606 | Bacteria | 4371 |
| 67 | Ga0466722_207506 | 3300042609 | Bacteria | 18414 |
| 68 | Ga0466698_127505 | 3300042610 | Bacteria | 18075 |
| 69 | Ga0123356_10003564 | 3300010049 | Bacteria | 16261 |
| 70 | Ga0466705_118364 | 3300042612 | Bacteria | 19256 |
| 71 | Ga0466732_088174 | 3300042656 | Bacteria | 4289 |
| 72 | Ga0466732_362147 | 3300042656 | Bacteria | 2389 |
| 73 | Ga0466692_070894 | 3300042591 | Bacteria | 5338 |
| 74 | Ga0466692_074346 | 3300042591 | Bacteria | 18199 |
| 75 | Ga0466692_182822 | 3300042591 | Unclassified | 2530 |
| 76 | Ga0466691_049649 | 3300042593 | Bacteria | 12533 |
| 77 | Ga0466691_121772 | 3300042593 | Bacteria | 1666 |
| 78 | Ga0466715_547327 | 3300042616 | Bacteria | 4968 |
| 79 | Ga0466723_076075 | 3300042618 | Bacteria | 14573 |
| 80 | Ga0466726_003768 | 3300042619 | Bacteria | 3831 |
| 81 | Ga0466726_058764 | 3300042619 | Bacteria | 2181 |
| 82 | Ga0466703_000505 | 3300042636 | Bacteria | 2159 |
| 83 | Ga0466703_023864 | 3300042636 | Bacteria | 16522 |
| 84 | Ga0466704_058561 | 3300042643 | Bacteria | 6264 |
| 85 | Ga0466704_083456 | 3300042643 | Bacteria | 4555 |
| 86 | Ga0466709_215991 | 3300042648 | Bacteria | 21139 |
| 87 | Ga0466727_028484 | 3300042655 | Bacteria | 6220 |
| 88 | Ga0466719_007530 | 3300042606 | Unclassified | 6954 |
| 89 | Ga0466720_063073 | 3300042607 | Bacteria | 19134 |
| 90 | Ga0466720_129485 | 3300042607 | Bacteria | 14228 |
| 91 | Ga0466705_023597 | 3300042612 | Bacteria | 9313 |
| 92 | Ga0466727_351835 | 3300042655 | Bacteria | 23710 |
| 93 | Ga0264413_100027 | 3300024493 | Bacteria | 30442 |
| 94 | Ga0466690_270804 | 3300042590 | Bacteria | 7583 |
| 95 | Ga0466691_030299 | 3300042593 | Bacteria | 7416 |
| 96 | Ga0466696_204246 | 3300042596 | Bacteria | 14923 |
| 97 | JGI24695J34938_10025164 | 3300002450 | Bacteria | 2849 |
| 98 | JGI24702J35022_10098087 | 3300002462 | Bacteria | 1601 |
| 99 | Ga0466712_079378 | 3300042614 | Bacteria | 31085 |
| 100 | Ga0466715_068797 | 3300042616 | Bacteria | 13415 |
| 101 | Ga0466726_023563 | 3300042619 | Bacteria | 3133 |
| 102 | Ga0466728_044878 | 3300042620 | Bacteria | 9100 |
| 103 | Ga0466704_523983 | 3300042643 | Bacteria | 32009 |
| 104 | Ga0466709_416555 | 3300042648 | Bacteria | 26652 |
| 105 | Ga0466727_033611 | 3300042655 | Bacteria | 2348 |
| 106 | Ga0466727_107613 | 3300042655 | Bacteria | 1551 |
| 107 | Ga0466700_390491 | 3300042600 | Bacteria | 1644 |
| 108 | Ga0466707_418121 | 3300042601 | Bacteria | 3613 |
| 109 | Ga0466716_072069 | 3300042605 | Bacteria | 16699 |
| 110 | Ga0466720_025670 | 3300042607 | Bacteria | 4699 |
| 111 | Ga0466698_451569 | 3300042610 | Bacteria | 3201 |
| 112 | Ga0123356_10164501 | 3300010049 | Bacteria | 2221 |
| 113 | Ga0466705_016508 | 3300042612 | Bacteria | 4496 |
| 114 | Ga0466732_115342 | 3300042656 | Bacteria | 1625 |
| 115 | Ga0466690_047607 | 3300042590 | Bacteria | 17366 |
| 116 | Ga0466692_108157 | 3300042591 | Bacteria | 26610 |
| 117 | Ga0466691_068317 | 3300042593 | Bacteria | 43845 |
| 118 | Ga0466694_194070 | 3300042594 | Bacteria | 1246 |
| 119 | Ga0466694_329436 | 3300042594 | Bacteria | 3286 |
| 120 | Ga0466712_318684 | 3300042614 | Bacteria | 5026 |
| 121 | Ga0466711_184001 | 3300042615 | Bacteria | 24586 |
| 122 | Ga0466711_409913 | 3300042615 | Unclassified | 4074 |
| 123 | Ga0466715_068985 | 3300042616 | Bacteria | 29330 |
| 124 | Ga0466715_590522 | 3300042616 | Bacteria | 2168 |
| 125 | Ga0466723_243195 | 3300042618 | Bacteria | 87629 |
| 126 | Ga0466728_036367 | 3300042620 | Bacteria | 7264 |
| 127 | Ga0466735_067876 | 3300042624 | Bacteria | 19585 |
| 128 | Ga0466703_083947 | 3300042636 | Bacteria | 12791 |
| 129 | Ga0466703_216415 | 3300042636 | Bacteria | 22191 |
| 130 | Ga0466727_221321 | 3300042655 | Bacteria | 1449 |
| 131 | Ga0466720_054034 | 3300042607 | Bacteria | 19093 |
| 132 | Ga0466722_135202 | 3300042609 | Bacteria | 7444 |
| 133 | Ga0123357_10056769 | 3300009784 | Bacteria | 5264 |
| 134 | Ga0123356_10002389 | 3300010049 | Bacteria | 20099 |
| 135 | Ga0123353_10020088 | 3300010167 | Bacteria | 9961 |
| 136 | Ga0466705_199691 | 3300042612 | Bacteria | 25313 |
| 137 | Ga0466705_241169 | 3300042612 | Bacteria | 18952 |
| 138 | Ga0466733_033224 | 3300042659 | Bacteria | 2275 |
| 139 | Ga0466733_046948 | 3300042659 | Bacteria | 19911 |
| 140 | Ga0466733_130414 | 3300042659 | Bacteria | 1762 |
| 141 | Ga0466691_088494 | 3300042593 | Bacteria | 33612 |
| 142 | AustNasuHG_c1000021 | 3300000089 | Bacteria | 36984 |
| 143 | AustNasuHG_c1000794 | 3300000089 | Bacteria | 11302 |
| 144 | AustNasuHG_c1003774 | 3300000089 | Bacteria | 5466 |
| 145 | JGI24698J34947_10025465 | 3300002449 | Bacteria | 3149 |
| 146 | JGI24695J34938_10000501 | 3300002450 | Bacteria | 38048 |
| 147 | JGI24695J34938_10001997 | 3300002450 | Bacteria | 16223 |
| 148 | Ga0466712_037219 | 3300042614 | Bacteria | 9147 |
| 149 | Ga0466715_152603 | 3300042616 | Unclassified | 4340 |
| 150 | Ga0466718_001438 | 3300042617 | Bacteria | 5265 |
| 151 | Ga0466718_060021 | 3300042617 | Bacteria | 7007 |
| 152 | Ga0466718_110221 | 3300042617 | Bacteria | 1517 |
| 153 | Ga0466723_023976 | 3300042618 | Bacteria | 16798 |
| 154 | Ga0466723_049340 | 3300042618 | Bacteria | 19117 |
| 155 | Ga0466723_069398 | 3300042618 | Bacteria | 18161 |
| 156 | Ga0466726_059745 | 3300042619 | Bacteria | 1884 |
| 157 | Ga0466726_135186 | 3300042619 | Bacteria | 1664 |
| 158 | Ga0466729_192345 | 3300042621 | Bacteria | 3083 |
| 159 | Ga0466729_317009 | 3300042621 | Bacteria | 1291 |
| 160 | Ga0466702_131151 | 3300042635 | Bacteria | 8127 |
| 161 | Ga0466703_212543 | 3300042636 | Bacteria | 7261 |
| 162 | Ga0466704_137481 | 3300042643 | Bacteria | 6754 |
| 163 | Ga0466704_263754 | 3300042643 | Bacteria | 34688 |
| 164 | Ga0466704_320787 | 3300042643 | Bacteria | 9317 |
| 165 | Ga0466704_378265 | 3300042643 | Bacteria | 4465 |
| 166 | Ga0466704_412370 | 3300042643 | Bacteria | 1579 |
| 167 | Ga0466708_028790 | 3300042652 | Bacteria | 17651 |
| 168 | Ga0466707_038490 | 3300042601 | Bacteria | 2569 |
| 169 | Ga0466719_099812 | 3300042606 | Bacteria | 30019 |
| 170 | Ga0466719_260373 | 3300042606 | Bacteria | 26617 |
| 171 | Ga0466722_055897 | 3300042609 | Bacteria | 3161 |
| 172 | Ga0466705_250306 | 3300042612 | Bacteria | 6601 |
| 173 | Ga0466733_111851 | 3300042659 | Bacteria | 82439 |
| 174 | Ga0466690_023641 | 3300042590 | Bacteria | 16783 |
| 175 | Ga0466690_339345 | 3300042590 | Bacteria | 11574 |
| 176 | Ga0466692_056577 | 3300042591 | Bacteria | 3337 |
| 177 | Ga0466693_272310 | 3300042592 | Bacteria | 2127 |
| 178 | Ga0466691_001134 | 3300042593 | Bacteria | 9308 |
| 179 | Ga0466694_070404 | 3300042594 | Bacteria | 1879 |
| 180 | AustNasuHG_c1001779 | 3300000089 | Bacteria | 7805 |
| 181 | JGI24695J34938_10000820 | 3300002450 | Bacteria | 28898 |
| 182 | JGI24695J34938_10007653 | 3300002450 | Bacteria | 6278 |
| 183 | JGI24695J34938_10022659 | 3300002450 | Bacteria | 3044 |
| 184 | Ga0466712_059606 | 3300042614 | Bacteria | 1406 |
| 185 | Ga0466715_098926 | 3300042616 | Bacteria | 8676 |
| 186 | Ga0466723_222530 | 3300042618 | Bacteria | 8667 |
| 187 | Ga0466726_480645 | 3300042619 | Bacteria | 2902 |
| 188 | Ga0466731_047750 | 3300042622 | Bacteria | 1837 |
| 189 | Ga0466703_002994 | 3300042636 | Bacteria | 7986 |
| 190 | Ga0466727_212494 | 3300042655 | Bacteria | 13739 |
| 191 | Ga0466716_292325 | 3300042605 | Bacteria | 4529 |
| 192 | Ga0466719_194349 | 3300042606 | Bacteria | 5958 |
| 193 | Ga0466719_448303 | 3300042606 | Bacteria | 4461 |
| 194 | Ga0123355_10198061 | 3300009826 | Bacteria | 2941 |
| 195 | Ga0123353_10112513 | 3300010167 | Bacteria | 4383 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 49 | 217 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.