Protein Family IF07950
Metagenome
Isolate
131
Members
42
Samples
127
Scaffolds
390.59
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_128036|Ga0466718_128036_9593_10762
- Length
- 389 aa
- Sequence
- MGKTLSYVLVTPYTIAKSRTGGVLARLLSRTDLDLVGAQMFAPDEKFAGDYANAIRNRAPSNQLMLLADYAKKNFAPSGGRPHRTLLLLFRGENSSEQLLNACGHIYTQHVEIDAIAGETIRDTYSDLIFDDDEPEKVRYFEPAVFTPRRQEESDFDLKLMAEFLDGRENIVENMKYPDPSIIERTLVIIKPDNWTHNSSRPGTIIDIFSRTGLRIVGIKVHRFSLSQALDFYSPVEAVLKDKLSYDYGKKAQELLEKEFNFKISDDLAETIISKFGKECARNQFLNIVEFMSGKRHIVPGEDITKAGNVKCMIIVYEGENAVKKIRDALGATDPTQAAEGTVRREFGSNIMVNTAHASDSVESYNREKKIVRIDNNSVVSIIREHLNA
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Kalotermitidae
35.0%
Unclassified
12.5%
Termopsidae
7.5%
Rhinotermitidae
5.0%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 22 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_219570 | 3300042612 | Bacteria | 8349 |
| 2 | Ga0466732_309835 | 3300042656 | Bacteria | 3296 |
| 3 | Ga0123353_10174607 | 3300010167 | Bacteria | 3408 |
| 4 | Ga0123353_10512535 | 3300010167 | Bacteria | 1743 |
| 5 | Ga0466707_397153 | 3300042601 | Bacteria | 3122 |
| 6 | Ga0466720_068866 | 3300042607 | Bacteria | 12056 |
| 7 | Ga0466720_217984 | 3300042607 | Bacteria | 4473 |
| 8 | Ga0466712_086617 | 3300042614 | Bacteria | 6110 |
| 9 | Ga0466711_406500 | 3300042615 | Bacteria | 12045 |
| 10 | Ga0466718_014665 | 3300042617 | Bacteria | 4385 |
| 11 | Ga0466723_240789 | 3300042618 | Bacteria | 10843 |
| 12 | JGI24695J34938_10001011 | 3300002450 | Bacteria | 25489 |
| 13 | JGI24695J34938_10013810 | 3300002450 | Bacteria | 4222 |
| 14 | Ga0466735_023885 | 3300042624 | Bacteria | 2062 |
| 15 | Ga0466703_094897 | 3300042636 | Bacteria | 6589 |
| 16 | Ga0466703_144745 | 3300042636 | Bacteria | 1246 |
| 17 | Ga0466704_285386 | 3300042643 | Bacteria | 59541 |
| 18 | Ga0466708_172200 | 3300042652 | Bacteria | 11127 |
| 19 | Ga0466727_008209 | 3300042655 | Bacteria | 3724 |
| 20 | Ga0466690_379489 | 3300042590 | Bacteria | 2097 |
| 21 | Ga0466692_069278 | 3300042591 | Bacteria | 1517 |
| 22 | Ga0466694_234605 | 3300042594 | Bacteria | 2692 |
| 23 | Ga0466699_286350 | 3300042597 | Bacteria | 3718 |
| 24 | Ga0123356_10300036 | 3300010049 | Bacteria | 1711 |
| 25 | Ga0466707_034242 | 3300042601 | Bacteria | 2329 |
| 26 | Ga0466719_248761 | 3300042606 | Bacteria | 6606 |
| 27 | Ga0466705_388878 | 3300042612 | Bacteria | 5968 |
| 28 | Ga0466712_289910 | 3300042614 | Bacteria | 1946 |
| 29 | Ga0466715_016827 | 3300042616 | Bacteria | 6026 |
| 30 | Ga0466715_049227 | 3300042616 | Bacteria | 2631 |
| 31 | Ga0072940_1013986 | 3300005200 | Bacteria | 6653 |
| 32 | Ga0466704_047715 | 3300042643 | Bacteria | 5670 |
| 33 | Ga0466704_072574 | 3300042643 | Bacteria | 2020 |
| 34 | Ga0466704_134068 | 3300042643 | Bacteria | 5725 |
| 35 | Ga0466690_208983 | 3300042590 | Bacteria | 2753 |
| 36 | Ga0466692_064978 | 3300042591 | Bacteria | 1614 |
| 37 | Ga0466692_097520 | 3300042591 | Bacteria | 2897 |
| 38 | Ga0466732_438188 | 3300042656 | Bacteria | 14903 |
| 39 | Ga0123356_10002571 | 3300010049 | Bacteria | 19353 |
| 40 | Ga0123353_10042675 | 3300010167 | Bacteria | 7176 |
| 41 | Ga0466716_037797 | 3300042605 | Bacteria | 7124 |
| 42 | Ga0466722_070145 | 3300042609 | Bacteria | 18780 |
| 43 | Ga0466718_070218 | 3300042617 | Bacteria | 7320 |
| 44 | Ga0466723_351193 | 3300042618 | Bacteria | 10633 |
| 45 | Ga0466726_068790 | 3300042619 | Bacteria | 2225 |
| 46 | JGI24698J34947_10026221 | 3300002449 | Bacteria | 3099 |
| 47 | JGI24698J34947_10027239 | 3300002449 | Bacteria | 3033 |
| 48 | Ga0466703_331126 | 3300042636 | Bacteria | 2094 |
| 49 | Ga0466709_402809 | 3300042648 | Bacteria | 12806 |
| 50 | Ga0466696_369649 | 3300042596 | Bacteria | 8210 |
| 51 | Ga0466732_161753 | 3300042656 | Bacteria | 2236 |
| 52 | Ga0466732_312056 | 3300042656 | Bacteria | 2672 |
| 53 | Ga0466711_026477 | 3300042615 | Bacteria | 2594 |
| 54 | Ga0466718_082891 | 3300042617 | Bacteria | 21508 |
| 55 | AustNasuHG_c1028553 | 3300000089 | Bacteria | 1662 |
| 56 | JGI24698J34947_10007694 | 3300002449 | Bacteria | 5918 |
| 57 | Ga0466703_109816 | 3300042636 | Bacteria | 1525 |
| 58 | Ga0466709_382976 | 3300042648 | Bacteria | 2605 |
| 59 | Ga0415639_034514 | 3300038395 | Bacteria | 8397 |
| 60 | Ga0466690_107520 | 3300042590 | Bacteria | 4017 |
| 61 | Ga0466692_145041 | 3300042591 | Bacteria | 1934 |
| 62 | Ga0466699_084576 | 3300042597 | Bacteria | 7639 |
| 63 | Ga0466705_072656 | 3300042612 | Bacteria | 21718 |
| 64 | Ga0466732_032090 | 3300042656 | Bacteria | 3931 |
| 65 | Ga0466732_274268 | 3300042656 | Bacteria | 1575 |
| 66 | Ga0123356_10007413 | 3300010049 | Bacteria | 10947 |
| 67 | Ga0466719_007485 | 3300042606 | Bacteria | 9552 |
| 68 | Ga0466720_014626 | 3300042607 | Bacteria | 80288 |
| 69 | Ga0466722_157823 | 3300042609 | Bacteria | 10580 |
| 70 | Ga0466712_004637 | 3300042614 | Bacteria | 2614 |
| 71 | Ga0466718_128036 | 3300042617 | Bacteria | 29323 |
| 72 | Ga0466723_123393 | 3300042618 | Bacteria | 21773 |
| 73 | Ga0466726_446332 | 3300042619 | Bacteria | 1254 |
| 74 | Ga0466728_082954 | 3300042620 | Bacteria | 3249 |
| 75 | Ga0466728_232497 | 3300042620 | Bacteria | 2589 |
| 76 | Ga0072940_1008612 | 3300005200 | Unclassified | 5511 |
| 77 | Ga0072941_1005953 | 3300005201 | Bacteria | 5709 |
| 78 | Ga0415639_259621 | 3300038395 | Unclassified | 1473 |
| 79 | Ga0466692_107939 | 3300042591 | Bacteria | 4444 |
| 80 | Ga0466722_105401 | 3300042609 | Bacteria | 4522 |
| 81 | Ga0466718_092209 | 3300042617 | Bacteria | 73198 |
| 82 | JGI24695J34938_10001688 | 3300002450 | Bacteria | 18269 |
| 83 | Ga0072941_1036910 | 3300005201 | Bacteria | 6885 |
| 84 | Ga0466703_020064 | 3300042636 | Bacteria | 24786 |
| 85 | Ga0466703_301095 | 3300042636 | Bacteria | 13764 |
| 86 | Ga0466708_061663 | 3300042652 | Bacteria | 2328 |
| 87 | Ga0466727_263819 | 3300042655 | Bacteria | 2765 |
| 88 | Ga0466692_117275 | 3300042591 | Bacteria | 5613 |
| 89 | Ga0466699_158422 | 3300042597 | Bacteria | 7069 |
| 90 | Ga0466722_260140 | 3300042609 | Bacteria | 2090 |
| 91 | AustNasuHG_c1012327 | 3300000089 | Bacteria | 2951 |
| 92 | JGI24698J34947_10001077 | 3300002449 | Unclassified | 14051 |
| 93 | JGI24698J34947_10014913 | 3300002449 | Bacteria | 4231 |
| 94 | Ga0072940_1002738 | 3300005200 | Bacteria | 9039 |
| 95 | Ga0466702_050972 | 3300042635 | Bacteria | 6920 |
| 96 | Ga0466703_305742 | 3300042636 | Bacteria | 2969 |
| 97 | Ga0466708_091335 | 3300042652 | Bacteria | 5217 |
| 98 | Ga0466708_220875 | 3300042652 | Bacteria | 7168 |
| 99 | Ga0264413_102550 | 3300024493 | Bacteria | 9378 |
| 100 | Ga0466691_034369 | 3300042593 | Bacteria | 6192 |
| 101 | Ga0466694_002948 | 3300042594 | Bacteria | 2844 |
| 102 | Ga0466694_087396 | 3300042594 | Bacteria | 2333 |
| 103 | Ga0466696_186899 | 3300042596 | Bacteria | 28959 |
| 104 | Ga0466699_002311 | 3300042597 | Bacteria | 5839 |
| 105 | Ga0466699_285186 | 3300042597 | Bacteria | 1657 |
| 106 | Ga0466699_367234 | 3300042597 | Bacteria | 2749 |
| 107 | Ga0466705_218666 | 3300042612 | Bacteria | 3489 |
| 108 | Ga0123355_10177081 | 3300009826 | Bacteria | 3174 |
| 109 | Ga0123353_10228737 | 3300010167 | Bacteria | 2901 |
| 110 | Ga0466720_025542 | 3300042607 | Bacteria | 24900 |
| 111 | Ga0466720_063233 | 3300042607 | Bacteria | 28550 |
| 112 | Ga0466720_122145 | 3300042607 | Bacteria | 8163 |
| 113 | Ga0466698_361351 | 3300042610 | Bacteria | 2673 |
| 114 | Ga0466712_081742 | 3300042614 | Bacteria | 2223 |
| 115 | Ga0466712_144144 | 3300042614 | Bacteria | 19900 |
| 116 | Ga0466715_000828 | 3300042616 | Bacteria | 15499 |
| 117 | Ga0466715_132396 | 3300042616 | Bacteria | 3645 |
| 118 | Ga0466726_391843 | 3300042619 | Bacteria | 10306 |
| 119 | JGI24695J34938_10046201 | 3300002450 | Bacteria | 1928 |
| 120 | Ga0072941_1033337 | 3300005201 | Bacteria | 11508 |
| 121 | Ga0466702_088460 | 3300042635 | Bacteria | 4088 |
| 122 | Ga0466704_155887 | 3300042643 | Bacteria | 4831 |
| 123 | Ga0466709_213018 | 3300042648 | Bacteria | 76747 |
| 124 | Ga0466708_365027 | 3300042652 | Bacteria | 4283 |
| 125 | Ga0466692_001720 | 3300042591 | Bacteria | 10896 |
| 126 | Ga0466696_306602 | 3300042596 | Bacteria | 2427 |
| 127 | Ga0466699_049603 | 3300042597 | Bacteria | 4381 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00334 | NDK | Nucleoside diphosphate kinase | 311 | 371 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.