Protein Family IF07931
Metagenome
Isolate
139
Members
47
Samples
136
Scaffolds
361.98
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_091602|Ga0466718_091602_315_1691
- Length
- 426 aa
- Sequence
- MHATMVLKADNKIVRREISYRDNLKCTYLSKADGKNKFIKKYLIVVKSKYFCAVKNNNMITLGNLELDTVHLGDCIELLKRVPDNSIDLIFADPPYNLQLNGELYRPNQTKVDAVDDAWDKFDSKEDYDKFTAAWMKECYRILKNTGSFWVIGTYHNIFRVGTILQNTGFWMLNDVIWVKPNPMPNFKGTRFNNAHETLIWATKSKASNYTFHYHSLKAMNDDLQMRSDWWIPICQGAERIKVDGQKAHSTQKPEELLFRIILSTSNPDDTVLDPFSGSGTTAAVAKRLGRRYIAFEREEFYVNVSNDRLEKIEPIEKTLLEYRIETKKPKVPFGNLVEKGYVKTGEYLYSKDGKTYAQVQADASITKDDITGSIHKVSAAVSGKSSNNGWDYWYIKRDNRLISIDELRYDYETKYLKPAKKENNL
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.8%
Kalotermitidae
30.4%
Unclassified
10.9%
Rhinotermitidae
6.5%
Termopsidae
4.3%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 2 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 5 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 14 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_134745 | 3300042612 | Bacteria | 6424 |
| 2 | Ga0466712_106716 | 3300042614 | Bacteria | 19386 |
| 3 | Ga0466712_170696 | 3300042614 | Unclassified | 3568 |
| 4 | Ga0466711_306485 | 3300042615 | Bacteria | 2364 |
| 5 | Ga0466718_009638 | 3300042617 | Unclassified | 1300 |
| 6 | Ga0466691_130789 | 3300042593 | Bacteria | 5111 |
| 7 | Ga0466694_100547 | 3300042594 | Bacteria | 1552 |
| 8 | Ga0466699_059932 | 3300042597 | Bacteria | 1489 |
| 9 | Ga0466713_000957 | 3300042602 | Bacteria | 2550 |
| 10 | Ga0466713_115571 | 3300042602 | Unclassified | 1727 |
| 11 | Ga0466716_328560 | 3300042605 | Bacteria | 3469 |
| 12 | JGI24698J34947_10001585 | 3300002449 | Bacteria | 12060 |
| 13 | JGI24695J34938_10003221 | 3300002450 | Bacteria | 11563 |
| 14 | Ga0466731_070281 | 3300042622 | Bacteria | 2491 |
| 15 | Ga0466704_207115 | 3300042643 | Bacteria | 4970 |
| 16 | Ga0466709_108709 | 3300042648 | Bacteria | 12295 |
| 17 | Ga0466723_243688 | 3300042618 | Bacteria | 83097 |
| 18 | Ga0123356_10026876 | 3300010049 | Bacteria | 5397 |
| 19 | Ga0466696_095000 | 3300042596 | Bacteria | 1830 |
| 20 | Ga0466699_127216 | 3300042597 | Unclassified | 3748 |
| 21 | Ga0466717_143004 | 3300042604 | Bacteria | 2117 |
| 22 | Ga0466698_036574 | 3300042610 | Bacteria | 1404 |
| 23 | Ga0466698_481064 | 3300042610 | Bacteria | 2971 |
| 24 | JGI24698J34947_10006433 | 3300002449 | Bacteria | 6447 |
| 25 | Ga0466704_207261 | 3300042643 | Bacteria | 2160 |
| 26 | Ga0466708_020107 | 3300042652 | Unclassified | 5231 |
| 27 | Ga0466718_112263 | 3300042617 | Bacteria | 3406 |
| 28 | Ga0466723_022561 | 3300042618 | Bacteria | 12696 |
| 29 | Ga0456237_0000350 | 3300041968 | Bacteria | 6854 |
| 30 | Ga0456237_0004266 | 3300041968 | Bacteria | 2302 |
| 31 | Ga0466690_047430 | 3300042590 | Bacteria | 4417 |
| 32 | Ga0466692_100376 | 3300042591 | Bacteria | 2211 |
| 33 | Ga0466694_158998 | 3300042594 | Bacteria | 17627 |
| 34 | Ga0466707_241518 | 3300042601 | Bacteria | 2977 |
| 35 | Ga0466716_042109 | 3300042605 | Bacteria | 3735 |
| 36 | Ga0466719_365757 | 3300042606 | Bacteria | 2525 |
| 37 | Ga0466720_182256 | 3300042607 | Bacteria | 12883 |
| 38 | Ga0466722_019519 | 3300042609 | Bacteria | 2400 |
| 39 | Ga0466722_190971 | 3300042609 | Bacteria | 12252 |
| 40 | Ga0466722_245350 | 3300042609 | Bacteria | 5930 |
| 41 | JGI24695J34938_10032041 | 3300002450 | Bacteria | 2432 |
| 42 | Ga0466703_126419 | 3300042636 | Bacteria | 30129 |
| 43 | Ga0466709_409510 | 3300042648 | Bacteria | 8588 |
| 44 | Ga0466708_051747 | 3300042652 | Bacteria | 2776 |
| 45 | Ga0466708_325861 | 3300042652 | Bacteria | 13144 |
| 46 | Ga0466708_388808 | 3300042652 | Bacteria | 1796 |
| 47 | Ga0466727_303365 | 3300042655 | Bacteria | 3090 |
| 48 | Ga0466712_057140 | 3300042614 | Bacteria | 6750 |
| 49 | Ga0466712_179498 | 3300042614 | Unclassified | 5221 |
| 50 | Ga0466711_405839 | 3300042615 | Bacteria | 2402 |
| 51 | Ga0466715_020672 | 3300042616 | Bacteria | 1531 |
| 52 | Ga0466715_054399 | 3300042616 | Bacteria | 7080 |
| 53 | Ga0466718_000702 | 3300042617 | Bacteria | 1776 |
| 54 | Ga0466718_091602 | 3300042617 | Bacteria | 1740 |
| 55 | Ga0466723_143911 | 3300042618 | Bacteria | 6339 |
| 56 | Ga0466723_169714 | 3300042618 | Bacteria | 5240 |
| 57 | Ga0466728_115952 | 3300042620 | Bacteria | 4129 |
| 58 | Ga0123353_10068294 | 3300010167 | Bacteria | 5707 |
| 59 | Ga0123354_10022429 | 3300010882 | Bacteria | 9954 |
| 60 | Ga0466690_237927 | 3300042590 | Bacteria | 2618 |
| 61 | Ga0466691_083750 | 3300042593 | Bacteria | 9469 |
| 62 | Ga0466691_112664 | 3300042593 | Bacteria | 14114 |
| 63 | Ga0466691_122284 | 3300042593 | Bacteria | 2208 |
| 64 | Ga0466694_118712 | 3300042594 | Bacteria | 1885 |
| 65 | Ga0466696_340585 | 3300042596 | Bacteria | 5343 |
| 66 | Ga0466716_235614 | 3300042605 | Bacteria | 10884 |
| 67 | AustNasuHG_c1001060 | 3300000089 | Bacteria | 9880 |
| 68 | JGI24699J35502_11127207 | 3300002509 | Bacteria | 4107 |
| 69 | Ga0466703_010522 | 3300042636 | Bacteria | 8583 |
| 70 | Ga0466704_206989 | 3300042643 | Unclassified | 21841 |
| 71 | Ga0466709_195057 | 3300042648 | Bacteria | 3160 |
| 72 | Ga0466709_401900 | 3300042648 | Bacteria | 2728 |
| 73 | Ga0466732_026046 | 3300042656 | Bacteria | 5488 |
| 74 | Ga0466718_166177 | 3300042617 | Bacteria | 1503 |
| 75 | Ga0466723_113667 | 3300042618 | Bacteria | 3710 |
| 76 | Ga0466728_396531 | 3300042620 | Bacteria | 2016 |
| 77 | Ga0466690_232090 | 3300042590 | Bacteria | 1734 |
| 78 | Ga0466692_113399 | 3300042591 | Bacteria | 14052 |
| 79 | Ga0466691_001266 | 3300042593 | Bacteria | 6707 |
| 80 | Ga0466694_019065 | 3300042594 | Bacteria | 7413 |
| 81 | Ga0466696_009235 | 3300042596 | Bacteria | 4355 |
| 82 | Ga0466699_002169 | 3300042597 | Bacteria | 23386 |
| 83 | Ga0466699_150728 | 3300042597 | Bacteria | 1199 |
| 84 | Ga0466699_279899 | 3300042597 | Bacteria | 1170 |
| 85 | Ga0072941_1000702 | 3300005201 | Bacteria | 30804 |
| 86 | Ga0072941_1001257 | 3300005201 | Bacteria | 17884 |
| 87 | Ga0466703_380213 | 3300042636 | Bacteria | 16163 |
| 88 | Ga0466705_152600 | 3300042612 | Bacteria | 1655 |
| 89 | Ga0466705_366834 | 3300042612 | Bacteria | 7037 |
| 90 | Ga0466711_175339 | 3300042615 | Bacteria | 20337 |
| 91 | Ga0466718_089840 | 3300042617 | Bacteria | 13842 |
| 92 | Ga0466728_212152 | 3300042620 | Bacteria | 2510 |
| 93 | Ga0466728_237762 | 3300042620 | Bacteria | 1373 |
| 94 | Ga0123353_10208473 | 3300010167 | Unclassified | 3067 |
| 95 | Ga0466692_062400 | 3300042591 | Bacteria | 3106 |
| 96 | Ga0466696_175229 | 3300042596 | Bacteria | 8874 |
| 97 | Ga0466699_406527 | 3300042597 | Bacteria | 1289 |
| 98 | Ga0466716_372298 | 3300042605 | Bacteria | 3144 |
| 99 | Ga0466719_226074 | 3300042606 | Bacteria | 2187 |
| 100 | JGI24705J35276_12226201 | 3300002504 | Bacteria | 2825 |
| 101 | JGI24697J35500_11247441 | 3300002507 | Bacteria | 2406 |
| 102 | JGI24697J35500_11272128 | 3300002507 | Unclassified | 4805 |
| 103 | Ga0466702_177360 | 3300042635 | Bacteria | 3397 |
| 104 | Ga0466704_063927 | 3300042643 | Bacteria | 16564 |
| 105 | Ga0466704_068542 | 3300042643 | Unclassified | 9321 |
| 106 | Ga0466709_031679 | 3300042648 | Bacteria | 3480 |
| 107 | Ga0466709_407910 | 3300042648 | Bacteria | 7273 |
| 108 | Ga0466708_209727 | 3300042652 | Bacteria | 3270 |
| 109 | Ga0466708_391310 | 3300042652 | Bacteria | 18865 |
| 110 | Ga0466708_415237 | 3300042652 | Bacteria | 20285 |
| 111 | Ga0466727_255102 | 3300042655 | Bacteria | 2506 |
| 112 | Ga0466705_189343 | 3300042612 | Bacteria | 4955 |
| 113 | Ga0466732_014620 | 3300042656 | Bacteria | 1482 |
| 114 | Ga0466712_055483 | 3300042614 | Bacteria | 5179 |
| 115 | Ga0123353_10024429 | 3300010167 | Bacteria | 9175 |
| 116 | Ga0466696_061519 | 3300042596 | Bacteria | 2231 |
| 117 | Ga0466696_253798 | 3300042596 | Bacteria | 1491 |
| 118 | Ga0466699_101839 | 3300042597 | Bacteria | 2551 |
| 119 | Ga0466699_244713 | 3300042597 | Bacteria | 1723 |
| 120 | Ga0466701_094128 | 3300042598 | Bacteria | 1392 |
| 121 | Ga0466719_509285 | 3300042606 | Bacteria | 2380 |
| 122 | Ga0466722_071057 | 3300042609 | Bacteria | 8486 |
| 123 | Ga0466722_183565 | 3300042609 | Bacteria | 6344 |
| 124 | Ga0466734_107252 | 3300042623 | Bacteria | 1575 |
| 125 | Ga0466735_118420 | 3300042624 | Bacteria | 2329 |
| 126 | Ga0466723_069359 | 3300042618 | Bacteria | 6092 |
| 127 | Ga0466728_010911 | 3300042620 | Bacteria | 3026 |
| 128 | Ga0123356_10016090 | 3300010049 | Bacteria | 7148 |
| 129 | Ga0466696_148145 | 3300042596 | Bacteria | 2427 |
| 130 | Ga0466721_094549 | 3300042608 | Bacteria | 3106 |
| 131 | JGI24705J35276_12201286 | 3300002504 | Bacteria | 1615 |
| 132 | JGI24699J35502_11119238 | 3300002509 | Unclassified | 3156 |
| 133 | Ga0466704_064155 | 3300042643 | Bacteria | 8078 |
| 134 | Ga0466704_472078 | 3300042643 | Bacteria | 4773 |
| 135 | Ga0466704_617069 | 3300042643 | Bacteria | 1835 |
| 136 | Ga0466708_067983 | 3300042652 | Bacteria | 14209 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.