Protein Family IF07919
Metagenome
Isolate
273
Members
63
Samples
254
Scaffolds
340.37
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_076789|Ga0466718_076789_810_1937
- Length
- 375 aa
- Sequence
- VQPKAHYERFYPGIIHDIVLLCWRDHVNGFLMTQNEVSRSLSVLDDDGLPSNSGWSRQPTFFYDPLLITAPRRRISESDRYIVHSPTHLIIFEIRDDGLLGSTGISIISLRDKKRSTHTFMTPVPLGSFELPTTSVSGSSRWRKEKEKSGLDFICMESGARIIKADIPKFGHNRSLRGALVLLEPTGVESLVTNQRWRDEKNAFRYSRCTPCYFAEGVIQFGSSEIIFTRGNGWGIFDWNRGARPKADIRYWASACGMSGGRQLGFCVGYSWADSSAGTENGFFVDGKLHKLDQVTFHIPLSDWLSPWRFTSNDNRLEMIFTPHQERSESHSMLFYNLKRRQVCGSFSGKAQLDDGSVIEFQDLTGFAERSKTKY
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.7%
Unclassified
32.8%
Kalotermitidae
23.0%
Rhinotermitidae
3.3%
Termopsidae
3.3%
Taxonomy
Archaea
1
Bacteria
251
Eukaryota
0
Viruses
1
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 2 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 3 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 4 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 5 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 6 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 30 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 37 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 38 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 39 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 47 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 48 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 49 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 50 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 56 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 57 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 59 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 60 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 61 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 62 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_204432 | 3300042591 | Bacteria | 2913 |
| 2 | Ga0466694_000786 | 3300042594 | Bacteria | 4698 |
| 3 | Ga0466694_061045 | 3300042594 | Bacteria | 1581 |
| 4 | Ga0466699_004462 | 3300042597 | Bacteria | 57714 |
| 5 | Ga0466699_146802 | 3300042597 | Bacteria | 1776 |
| 6 | Ga0466699_235805 | 3300042597 | Bacteria | 2566 |
| 7 | Ga0123356_10005988 | 3300010049 | Bacteria | 12336 |
| 8 | Ga0466712_023717 | 3300042614 | Bacteria | 9407 |
| 9 | Ga0466712_255033 | 3300042614 | Bacteria | 17688 |
| 10 | Ga0466712_306616 | 3300042614 | Bacteria | 3305 |
| 11 | Ga0466711_114650 | 3300042615 | Bacteria | 15340 |
| 12 | Ga0466715_514303 | 3300042616 | Bacteria | 8248 |
| 13 | Ga0466715_528896 | 3300042616 | Bacteria | 10259 |
| 14 | Ga0466719_125584 | 3300042606 | Bacteria | 4181 |
| 15 | Ga0466719_244496 | 3300042606 | Unclassified | 1962 |
| 16 | Ga0466698_058765 | 3300042610 | Bacteria | 5791 |
| 17 | Ga0466698_381696 | 3300042610 | Bacteria | 1466 |
| 18 | Ga0466703_146179 | 3300042636 | Bacteria | 9559 |
| 19 | Ga0466708_073432 | 3300042652 | Bacteria | 1458 |
| 20 | Ga0466727_065260 | 3300042655 | Unclassified | 1804 |
| 21 | Ga0466727_262879 | 3300042655 | Bacteria | 1860 |
| 22 | JGI24698J34947_10042577 | 3300002449 | Bacteria | 2332 |
| 23 | JGI24695J34938_10000800 | 3300002450 | Bacteria | 29265 |
| 24 | JGI24695J34938_10026971 | 3300002450 | Bacteria | 2722 |
| 25 | JGI24695J34938_10032605 | 3300002450 | Unclassified | 2405 |
| 26 | Ga0072941_1067305 | 3300005201 | Bacteria | 4151 |
| 27 | Ga0072941_1096237 | 3300005201 | Bacteria | 5558 |
| 28 | Ga0466705_228519 | 3300042612 | Bacteria | 4462 |
| 29 | Ga0466732_094502 | 3300042656 | Bacteria | 4214 |
| 30 | Ga0466692_048976 | 3300042591 | Bacteria | 33733 |
| 31 | Ga0466693_189223 | 3300042592 | Bacteria | 4737 |
| 32 | Ga0466691_154216 | 3300042593 | Unclassified | 6712 |
| 33 | Ga0466696_032649 | 3300042596 | Bacteria | 10983 |
| 34 | Ga0466696_405498 | 3300042596 | Bacteria | 11772 |
| 35 | Ga0466699_008601 | 3300042597 | Bacteria | 19388 |
| 36 | Ga0466699_437648 | 3300042597 | Bacteria | 19484 |
| 37 | Ga0123356_10390151 | 3300010049 | Bacteria | 1527 |
| 38 | Ga0466711_062091 | 3300042615 | Bacteria | 8046 |
| 39 | Ga0466718_008689 | 3300042617 | Bacteria | 3048 |
| 40 | Ga0466723_042499 | 3300042618 | Bacteria | 30604 |
| 41 | Ga0466723_057097 | 3300042618 | Bacteria | 3852 |
| 42 | Ga0466728_302663 | 3300042620 | Bacteria | 4842 |
| 43 | Ga0466707_265672 | 3300042601 | Bacteria | 1944 |
| 44 | Ga0466721_020207 | 3300042608 | Bacteria | 45600 |
| 45 | Ga0466722_074297 | 3300042609 | Bacteria | 8732 |
| 46 | Ga0466730_099970 | 3300042625 | Bacteria | 1449 |
| 47 | Ga0466702_254023 | 3300042635 | Bacteria | 2512 |
| 48 | Ga0466702_276614 | 3300042635 | Bacteria | 7903 |
| 49 | Ga0466702_338013 | 3300042635 | Bacteria | 3626 |
| 50 | Ga0466704_573684 | 3300042643 | Bacteria | 1492 |
| 51 | JGI24698J34947_10002747 | 3300002449 | Bacteria | 9518 |
| 52 | JGI24698J34947_10041721 | 3300002449 | Bacteria | 2361 |
| 53 | JGI24695J34938_10000014 | 3300002450 | Bacteria | 120713 |
| 54 | JGI24695J34938_10000202 | 3300002450 | Bacteria | 56335 |
| 55 | JGI24695J34938_10024539 | 3300002450 | Bacteria | 2894 |
| 56 | Ga0072941_1013578 | 3300005201 | Bacteria | 3972 |
| 57 | Ga0072941_1156236 | 3300005201 | Bacteria | 2029 |
| 58 | Ga0466705_188606 | 3300042612 | Bacteria | 2495 |
| 59 | Ga0466732_012973 | 3300042656 | Bacteria | 30059 |
| 60 | Ga0415639_073139 | 3300038395 | Bacteria | 5208 |
| 61 | Ga0466690_004731 | 3300042590 | Bacteria | 11113 |
| 62 | Ga0466690_103325 | 3300042590 | Bacteria | 5906 |
| 63 | Ga0466692_133624 | 3300042591 | Bacteria | 1723 |
| 64 | Ga0466699_223249 | 3300042597 | Bacteria | 2818 |
| 65 | Ga0466699_335504 | 3300042597 | Bacteria | 2612 |
| 66 | Ga0123356_10004796 | 3300010049 | Bacteria | 13917 |
| 67 | Ga0123356_10011542 | 3300010049 | Bacteria | 8606 |
| 68 | Ga0466712_051628 | 3300042614 | Unclassified | 7013 |
| 69 | Ga0466712_159242 | 3300042614 | Bacteria | 52985 |
| 70 | Ga0466711_198029 | 3300042615 | Bacteria | 45882 |
| 71 | Ga0466718_025092 | 3300042617 | Bacteria | 7660 |
| 72 | Ga0466723_024307 | 3300042618 | Bacteria | 8462 |
| 73 | Ga0466723_071038 | 3300042618 | Bacteria | 15332 |
| 74 | Ga0466728_131899 | 3300042620 | Bacteria | 5880 |
| 75 | Ga0466719_189669 | 3300042606 | Bacteria | 2806 |
| 76 | Ga0466720_094561 | 3300042607 | Bacteria | 5680 |
| 77 | Ga0466703_102878 | 3300042636 | Bacteria | 11153 |
| 78 | Ga0466703_103300 | 3300042636 | Bacteria | 2689 |
| 79 | Ga0466704_253264 | 3300042643 | Bacteria | 2667 |
| 80 | Ga0466704_378085 | 3300042643 | Bacteria | 22325 |
| 81 | Ga0466708_011373 | 3300042652 | Bacteria | 5360 |
| 82 | Ga0466727_335087 | 3300042655 | Bacteria | 6603 |
| 83 | JGI24698J34947_10006000 | 3300002449 | Bacteria | 6667 |
| 84 | JGI24698J34947_10010823 | 3300002449 | Bacteria | 5007 |
| 85 | JGI24695J34938_10000045 | 3300002450 | Bacteria | 92650 |
| 86 | JGI24695J34938_10002417 | 3300002450 | Bacteria | 14322 |
| 87 | JGI24695J34938_10006243 | 3300002450 | Bacteria | 7227 |
| 88 | JGI24695J34938_10006285 | 3300002450 | Bacteria | 7188 |
| 89 | JGI24695J34938_10025865 | 3300002450 | Bacteria | 2798 |
| 90 | Ga0072941_1002583 | 3300005201 | Bacteria | 2736 |
| 91 | Ga0072941_1042602 | 3300005201 | Bacteria | 2133 |
| 92 | Ga0466705_013208 | 3300042612 | Bacteria | 3388 |
| 93 | Ga0466691_059633 | 3300042593 | Bacteria | 4697 |
| 94 | Ga0123356_10002807 | 3300010049 | Bacteria | 18453 |
| 95 | Ga0123356_10215406 | 3300010049 | Bacteria | 1973 |
| 96 | Ga0123356_10238641 | 3300010049 | Viruses | 1887 |
| 97 | Ga0123356_10263849 | 3300010049 | Bacteria | 1808 |
| 98 | Ga0123356_10780383 | 3300010049 | Bacteria | 1126 |
| 99 | Ga0123353_10168225 | 3300010167 | Bacteria | 3482 |
| 100 | Ga0466712_000594 | 3300042614 | Bacteria | 29291 |
| 101 | Ga0466712_004341 | 3300042614 | Bacteria | 19805 |
| 102 | Ga0466718_124550 | 3300042617 | Bacteria | 2187 |
| 103 | Ga0466723_328735 | 3300042618 | Bacteria | 2794 |
| 104 | Ga0466726_214281 | 3300042619 | Bacteria | 2370 |
| 105 | Ga0466726_292323 | 3300042619 | Bacteria | 2548 |
| 106 | Ga0466726_436469 | 3300042619 | Bacteria | 9306 |
| 107 | Ga0466716_387165 | 3300042605 | Unclassified | 3951 |
| 108 | Ga0466720_044566 | 3300042607 | Unclassified | 1072 |
| 109 | Ga0466702_438499 | 3300042635 | Bacteria | 3867 |
| 110 | Ga0466703_032667 | 3300042636 | Bacteria | 2798 |
| 111 | Ga0466703_115868 | 3300042636 | Unclassified | 1479 |
| 112 | Ga0466704_250109 | 3300042643 | Bacteria | 7069 |
| 113 | Ga0466709_152852 | 3300042648 | Bacteria | 4433 |
| 114 | Ga0466709_167321 | 3300042648 | Bacteria | 6018 |
| 115 | Ga0466727_198138 | 3300042655 | Bacteria | 1232 |
| 116 | JGI24698J34947_10018538 | 3300002449 | Bacteria | 3759 |
| 117 | JGI24695J34938_10000027 | 3300002450 | Bacteria | 107415 |
| 118 | JGI24695J34938_10005242 | 3300002450 | Bacteria | 8174 |
| 119 | JGI24695J34938_10018415 | 3300002450 | Bacteria | 3492 |
| 120 | Ga0072941_1158505 | 3300005201 | Bacteria | 5546 |
| 121 | Ga0466705_266738 | 3300042612 | Bacteria | 2630 |
| 122 | Ga0415639_017797 | 3300038395 | Bacteria | 3546 |
| 123 | Ga0466691_022401 | 3300042593 | Bacteria | 17867 |
| 124 | Ga0466691_088084 | 3300042593 | Bacteria | 3119 |
| 125 | Ga0466694_189320 | 3300042594 | Bacteria | 39847 |
| 126 | Ga0466694_251440 | 3300042594 | Bacteria | 1723 |
| 127 | Ga0466696_109139 | 3300042596 | Bacteria | 8969 |
| 128 | Ga0466696_202123 | 3300042596 | Bacteria | 8908 |
| 129 | Ga0123356_10001011 | 3300010049 | Bacteria | 31243 |
| 130 | Ga0123353_10451431 | 3300010167 | Bacteria | 1892 |
| 131 | Ga0466712_142488 | 3300042614 | Bacteria | 31740 |
| 132 | Ga0466718_076789 | 3300042617 | Bacteria | 1965 |
| 133 | Ga0466700_206546 | 3300042600 | Bacteria | 6421 |
| 134 | Ga0466720_008542 | 3300042607 | Bacteria | 40016 |
| 135 | Ga0466720_075649 | 3300042607 | Bacteria | 7015 |
| 136 | Ga0466720_107863 | 3300042607 | Bacteria | 1671 |
| 137 | Ga0466722_058933 | 3300042609 | Bacteria | 17392 |
| 138 | Ga0466702_247200 | 3300042635 | Bacteria | 5018 |
| 139 | Ga0466704_016563 | 3300042643 | Bacteria | 5380 |
| 140 | Ga0466704_125296 | 3300042643 | Bacteria | 7113 |
| 141 | Ga0466709_012300 | 3300042648 | Bacteria | 9353 |
| 142 | Ga0466708_164786 | 3300042652 | Bacteria | 6600 |
| 143 | JGI24698J34947_10006117 | 3300002449 | Bacteria | 6606 |
| 144 | JGI24695J34938_10000274 | 3300002450 | Bacteria | 50501 |
| 145 | Ga0072940_1351076 | 3300005200 | Bacteria | 2406 |
| 146 | Ga0072941_1003629 | 3300005201 | Bacteria | 49512 |
| 147 | Ga0466732_035658 | 3300042656 | Bacteria | 9095 |
| 148 | Ga0415639_002570 | 3300038395 | Bacteria | 22305 |
| 149 | Ga0466692_059576 | 3300042591 | Bacteria | 31204 |
| 150 | Ga0466694_021996 | 3300042594 | Bacteria | 62944 |
| 151 | Ga0466694_361924 | 3300042594 | Archaea | 3153 |
| 152 | Ga0466696_101268 | 3300042596 | Bacteria | 6025 |
| 153 | Ga0466696_143997 | 3300042596 | Bacteria | 3848 |
| 154 | Ga0123356_10000529 | 3300010049 | Bacteria | 42474 |
| 155 | Ga0123356_10067720 | 3300010049 | Bacteria | 3344 |
| 156 | Ga0466705_412030 | 3300042612 | Bacteria | 3533 |
| 157 | Ga0466712_023315 | 3300042614 | Bacteria | 46913 |
| 158 | Ga0466718_149605 | 3300042617 | Bacteria | 1445 |
| 159 | Ga0466723_043547 | 3300042618 | Bacteria | 27587 |
| 160 | Ga0466726_231278 | 3300042619 | Bacteria | 2553 |
| 161 | Ga0466717_236402 | 3300042604 | Bacteria | 1118 |
| 162 | Ga0466719_084034 | 3300042606 | Bacteria | 3453 |
| 163 | Ga0466704_042140 | 3300042643 | Bacteria | 14631 |
| 164 | Ga0466704_143993 | 3300042643 | Bacteria | 7189 |
| 165 | Ga0466708_081248 | 3300042652 | Bacteria | 5041 |
| 166 | Ga0466727_270598 | 3300042655 | Bacteria | 4061 |
| 167 | AustNasuHG_c1004938 | 3300000089 | Bacteria | 4773 |
| 168 | AustNasuHG_c1005259 | 3300000089 | Bacteria | 4624 |
| 169 | JGI24698J34947_10028285 | 3300002449 | Bacteria | 2969 |
| 170 | JGI24695J34938_10021113 | 3300002450 | Bacteria | 3191 |
| 171 | JGI24695J34938_10068815 | 3300002450 | Bacteria | 1485 |
| 172 | Ga0466705_094451 | 3300042612 | Bacteria | 2997 |
| 173 | Ga0466705_148048 | 3300042612 | Bacteria | 6221 |
| 174 | Ga0466705_234538 | 3300042612 | Unclassified | 4280 |
| 175 | Ga0466705_386387 | 3300042612 | Unclassified | 1454 |
| 176 | Ga0466732_022982 | 3300042656 | Unclassified | 3437 |
| 177 | Ga0264413_101259 | 3300024493 | Bacteria | 11414 |
| 178 | Ga0264413_101353 | 3300024493 | Bacteria | 18890 |
| 179 | Ga0466690_248379 | 3300042590 | Bacteria | 3180 |
| 180 | Ga0466691_157248 | 3300042593 | Bacteria | 4044 |
| 181 | Ga0466694_091303 | 3300042594 | Bacteria | 1448 |
| 182 | Ga0466699_024794 | 3300042597 | Unclassified | 1468 |
| 183 | Ga0123356_10000668 | 3300010049 | Bacteria | 37878 |
| 184 | Ga0123356_10006631 | 3300010049 | Bacteria | 11666 |
| 185 | Ga0123356_10015189 | 3300010049 | Bacteria | 7382 |
| 186 | Ga0123356_10441850 | 3300010049 | Bacteria | 1447 |
| 187 | Ga0466718_026865 | 3300042617 | Bacteria | 10065 |
| 188 | Ga0466723_075446 | 3300042618 | Bacteria | 2323 |
| 189 | Ga0466723_134425 | 3300042618 | Bacteria | 2014 |
| 190 | Ga0466726_111271 | 3300042619 | Unclassified | 2240 |
| 191 | Ga0466720_014621 | 3300042607 | Bacteria | 102324 |
| 192 | Ga0466720_074157 | 3300042607 | Unclassified | 7758 |
| 193 | Ga0466720_106133 | 3300042607 | Bacteria | 14194 |
| 194 | Ga0466722_100712 | 3300042609 | Bacteria | 4377 |
| 195 | Ga0466703_142474 | 3300042636 | Bacteria | 13749 |
| 196 | Ga0466704_072553 | 3300042643 | Bacteria | 3674 |
| 197 | Ga0466704_346596 | 3300042643 | Bacteria | 27825 |
| 198 | Ga0466708_052580 | 3300042652 | Unclassified | 2338 |
| 199 | 2230954205 | 2228664003 | Bacteria | 16559 |
| 200 | JGI24698J34947_10006229 | 3300002449 | Bacteria | 6554 |
| 201 | JGI24695J34938_10002366 | 3300002450 | Bacteria | 14513 |
| 202 | JGI24695J34938_10031084 | 3300002450 | Bacteria | 2481 |
| 203 | Ga0072940_1002923 | 3300005200 | Bacteria | 6175 |
| 204 | Ga0072940_1023360 | 3300005200 | Bacteria | 34349 |
| 205 | Ga0072941_1000976 | 3300005201 | Bacteria | 2916 |
| 206 | Ga0072941_1001021 | 3300005201 | Unclassified | 7193 |
| 207 | Ga0072941_1003884 | 3300005201 | Bacteria | 10093 |
| 208 | Ga0072941_1042601 | 3300005201 | Bacteria | 5826 |
| 209 | Ga0466705_277631 | 3300042612 | Bacteria | 36086 |
| 210 | Ga0466732_393124 | 3300042656 | Bacteria | 2021 |
| 211 | Ga0466690_349997 | 3300042590 | Unclassified | 2312 |
| 212 | Ga0466692_056950 | 3300042591 | Bacteria | 4083 |
| 213 | Ga0466699_071408 | 3300042597 | Bacteria | 37193 |
| 214 | Ga0123355_10121300 | 3300009826 | Bacteria | 4054 |
| 215 | Ga0123356_10000149 | 3300010049 | Bacteria | 78461 |
| 216 | Ga0123356_10000453 | 3300010049 | Bacteria | 46109 |
| 217 | Ga0123356_10000514 | 3300010049 | Bacteria | 43097 |
| 218 | Ga0123356_10017091 | 3300010049 | Bacteria | 6904 |
| 219 | Ga0123353_10817841 | 3300010167 | Bacteria | 1283 |
| 220 | Ga0466712_008358 | 3300042614 | Unclassified | 3002 |
| 221 | Ga0466712_179507 | 3300042614 | Bacteria | 2942 |
| 222 | Ga0466712_313785 | 3300042614 | Bacteria | 30906 |
| 223 | Ga0466715_079985 | 3300042616 | Bacteria | 9726 |
| 224 | Ga0466715_185924 | 3300042616 | Bacteria | 4245 |
| 225 | Ga0466715_460232 | 3300042616 | Bacteria | 24346 |
| 226 | Ga0466718_148271 | 3300042617 | Bacteria | 2622 |
| 227 | Ga0466728_008920 | 3300042620 | Bacteria | 17810 |
| 228 | Ga0466728_125718 | 3300042620 | Bacteria | 10600 |
| 229 | Ga0466716_121319 | 3300042605 | Bacteria | 7940 |
| 230 | Ga0466720_163083 | 3300042607 | Bacteria | 10057 |
| 231 | Ga0466731_039798 | 3300042622 | Bacteria | 2667 |
| 232 | Ga0466703_170439 | 3300042636 | Bacteria | 4528 |
| 233 | Ga0466704_076828 | 3300042643 | Unclassified | 2740 |
| 234 | Ga0466704_128809 | 3300042643 | Bacteria | 10820 |
| 235 | Ga0466704_139284 | 3300042643 | Bacteria | 4378 |
| 236 | Ga0466709_100140 | 3300042648 | Bacteria | 2789 |
| 237 | Ga0466709_118970 | 3300042648 | Bacteria | 11687 |
| 238 | Ga0466708_045937 | 3300042652 | Bacteria | 2410 |
| 239 | Ga0466708_103609 | 3300042652 | Unclassified | 2434 |
| 240 | Ga0466708_444914 | 3300042652 | Bacteria | 20712 |
| 241 | AustNasuHG_c1001283 | 3300000089 | Bacteria | 9019 |
| 242 | AustNasuHG_c1006132 | 3300000089 | Bacteria | 4297 |
| 243 | AustNasuHG_c1036826 | 3300000089 | Bacteria | 1261 |
| 244 | JGI24698J34947_10003807 | 3300002449 | Bacteria | 8220 |
| 245 | JGI24698J34947_10014438 | 3300002449 | Bacteria | 4301 |
| 246 | JGI24698J34947_10039174 | 3300002449 | Bacteria | 2454 |
| 247 | JGI24695J34938_10000259 | 3300002450 | Bacteria | 51394 |
| 248 | JGI24695J34938_10000364 | 3300002450 | Bacteria | 44922 |
| 249 | JGI24695J34938_10006882 | 3300002450 | Bacteria | 6749 |
| 250 | JGI24695J34938_10009645 | 3300002450 | Bacteria | 5352 |
| 251 | JGI24695J34938_10019816 | 3300002450 | Bacteria | 3322 |
| 252 | JGI24695J34938_10030106 | 3300002450 | Bacteria | 2531 |
| 253 | Ga0072941_1000922 | 3300005201 | Bacteria | 9343 |
| 254 | Ga0072941_1004007 | 3300005201 | Bacteria | 37001 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.