Protein Family IF07914
Metagenome
Isolate
119
Members
46
Samples
112
Scaffolds
273.61
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_069120|Ga0466718_069120_285_1238
- Length
- 317 aa
- Sequence
- LNGIFQDLSGTGTFEQSGFGDNKMKILYVAELVGKAGIYVLKKALPELKRQEQIDFTVICADGATGGNGLGRNHAGYIRKLGADAITTGDYCFYKKDLVENWVPTVVRPVNLGRMGNGQKQGHLSLEQVPGFGWRVFKVGGTGSPNQPRSVVKVAVAVFLGANFTRIRADNPFRELKPFLEKLQAETPYVVVDFHAWATGEKRIFFTVAAGLCTAVIGSHSRVQTADEAILDGTAVICDAGRTGSTESVGGTDSAVRIQEYLTEIPDWTKDAWEKCELQGVIVEADGQGRALCIKRLRIPVPAGNQKMPEPDISEEG
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Kalotermitidae
28.9%
Unclassified
15.6%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 11 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 20 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 44 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 45 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_034691 | 3300042612 | Bacteria | 7148 |
| 2 | Ga0466719_138573 | 3300042606 | Bacteria | 2036 |
| 3 | Ga0466722_061629 | 3300042609 | Bacteria | 5432 |
| 4 | JGI24695J34938_10000391 | 3300002450 | Bacteria | 43169 |
| 5 | JGI24695J34938_10004419 | 3300002450 | Unclassified | 9236 |
| 6 | JGI24695J34938_10010133 | 3300002450 | Bacteria | 5191 |
| 7 | Ga0072941_1002026 | 3300005201 | Bacteria | 4966 |
| 8 | Ga0466691_012013 | 3300042593 | Bacteria | 12727 |
| 9 | Ga0466691_220592 | 3300042593 | Bacteria | 13327 |
| 10 | Ga0466703_301732 | 3300042636 | Bacteria | 14083 |
| 11 | Ga0466704_094042 | 3300042643 | Bacteria | 2257 |
| 12 | Ga0466704_223682 | 3300042643 | Bacteria | 2884 |
| 13 | Ga0466704_324805 | 3300042643 | Bacteria | 1796 |
| 14 | Ga0466708_095269 | 3300042652 | Bacteria | 23314 |
| 15 | Ga0466715_073448 | 3300042616 | Bacteria | 4158 |
| 16 | Ga0466718_170094 | 3300042617 | Bacteria | 15036 |
| 17 | JGI24695J34938_10006087 | 3300002450 | Bacteria | 7345 |
| 18 | Ga0072941_1028093 | 3300005201 | Bacteria | 7087 |
| 19 | Ga0415639_130128 | 3300038395 | Bacteria | 6989 |
| 20 | Ga0466692_107500 | 3300042591 | Bacteria | 1063 |
| 21 | Ga0466691_059914 | 3300042593 | Bacteria | 14735 |
| 22 | Ga0466694_091564 | 3300042594 | Bacteria | 1220 |
| 23 | Ga0466702_174842 | 3300042635 | Bacteria | 3830 |
| 24 | Ga0466703_082590 | 3300042636 | Bacteria | 51436 |
| 25 | Ga0466718_069120 | 3300042617 | Bacteria | 1258 |
| 26 | Ga0466728_228471 | 3300042620 | Bacteria | 4080 |
| 27 | Ga0466717_075146 | 3300042604 | Bacteria | 3140 |
| 28 | Ga0466716_051368 | 3300042605 | Bacteria | 4644 |
| 29 | Ga0466693_081613 | 3300042592 | Bacteria | 56251 |
| 30 | Ga0466694_166663 | 3300042594 | Bacteria | 1201 |
| 31 | Ga0466702_073469 | 3300042635 | Bacteria | 14454 |
| 32 | Ga0466708_187178 | 3300042652 | Bacteria | 4109 |
| 33 | Ga0466708_431996 | 3300042652 | Bacteria | 3947 |
| 34 | Ga0466727_156801 | 3300042655 | Bacteria | 1939 |
| 35 | Ga0466727_348257 | 3300042655 | Bacteria | 1224 |
| 36 | Ga0466718_007774 | 3300042617 | Bacteria | 5468 |
| 37 | Ga0466718_009679 | 3300042617 | Bacteria | 7936 |
| 38 | Ga0466718_047454 | 3300042617 | Bacteria | 1579 |
| 39 | Ga0466732_246099 | 3300042656 | Bacteria | 1221 |
| 40 | Ga0466722_088142 | 3300042609 | Bacteria | 11867 |
| 41 | Nasutiter_Contig02598 | 2030936001 | Bacteria | 1525 |
| 42 | Ga0072941_1009383 | 3300005201 | Bacteria | 11845 |
| 43 | Ga0466731_296600 | 3300042622 | Bacteria | 2255 |
| 44 | Ga0466735_010857 | 3300042624 | Bacteria | 3672 |
| 45 | Ga0466704_314082 | 3300042643 | Bacteria | 2229 |
| 46 | Ga0466712_169515 | 3300042614 | Bacteria | 5416 |
| 47 | Ga0466712_230749 | 3300042614 | Bacteria | 2987 |
| 48 | Ga0466711_099713 | 3300042615 | Bacteria | 7714 |
| 49 | Ga0466715_622696 | 3300042616 | Bacteria | 8312 |
| 50 | Ga0466723_333488 | 3300042618 | Bacteria | 2890 |
| 51 | Ga0466716_474550 | 3300042605 | Unclassified | 4302 |
| 52 | Ga0466719_254533 | 3300042606 | Bacteria | 6301 |
| 53 | JGI24698J34947_10008558 | 3300002449 | Bacteria | 5617 |
| 54 | JGI24695J34938_10000324 | 3300002450 | Bacteria | 46911 |
| 55 | JGI24700J35501_10930493 | 3300002508 | Bacteria | 14694 |
| 56 | Ga0072940_1287264 | 3300005200 | Bacteria | 1511 |
| 57 | Ga0466703_218316 | 3300042636 | Bacteria | 2764 |
| 58 | Ga0466704_167806 | 3300042643 | Bacteria | 13695 |
| 59 | Ga0466708_140451 | 3300042652 | Bacteria | 25951 |
| 60 | Ga0466727_120668 | 3300042655 | Bacteria | 1318 |
| 61 | Ga0466727_330439 | 3300042655 | Bacteria | 1280 |
| 62 | Ga0466715_126101 | 3300042616 | Bacteria | 21047 |
| 63 | Ga0466718_114674 | 3300042617 | Bacteria | 2005 |
| 64 | Ga0466718_129353 | 3300042617 | Bacteria | 3606 |
| 65 | Ga0466723_156747 | 3300042618 | Bacteria | 14772 |
| 66 | Ga0466733_185573 | 3300042659 | Bacteria | 3847 |
| 67 | Ga0466700_014474 | 3300042600 | Bacteria | 1551 |
| 68 | Ga0466716_023000 | 3300042605 | Bacteria | 13846 |
| 69 | Ga0466716_140376 | 3300042605 | Bacteria | 16825 |
| 70 | JGI24698J34947_10009037 | 3300002449 | Bacteria | 5467 |
| 71 | JGI24698J34947_10129856 | 3300002449 | Bacteria | 1079 |
| 72 | JGI24695J34938_10012823 | 3300002450 | Unclassified | 4427 |
| 73 | Ga0415639_008208 | 3300038395 | Bacteria | 4391 |
| 74 | Ga0456237_0014503 | 3300041968 | Bacteria | 1123 |
| 75 | Ga0466692_017288 | 3300042591 | Bacteria | 31305 |
| 76 | Ga0466696_222543 | 3300042596 | Bacteria | 9272 |
| 77 | Ga0466735_004050 | 3300042624 | Bacteria | 3103 |
| 78 | Ga0466704_066849 | 3300042643 | Bacteria | 22409 |
| 79 | Ga0466708_130050 | 3300042652 | Bacteria | 3400 |
| 80 | Ga0466715_054604 | 3300042616 | Bacteria | 4131 |
| 81 | Ga0466723_043102 | 3300042618 | Bacteria | 3110 |
| 82 | Ga0466726_400468 | 3300042619 | Bacteria | 1737 |
| 83 | Ga0466732_314752 | 3300042656 | Bacteria | 1173 |
| 84 | Ga0466722_087624 | 3300042609 | Bacteria | 1488 |
| 85 | Ga0123353_11060947 | 3300010167 | Unclassified | 1081 |
| 86 | JGI24695J34938_10005854 | 3300002450 | Bacteria | 7561 |
| 87 | JGI24695J34938_10017130 | 3300002450 | Bacteria | 3662 |
| 88 | Ga0072941_1028092 | 3300005201 | Bacteria | 5793 |
| 89 | Ga0466694_138105 | 3300042594 | Bacteria | 4715 |
| 90 | Ga0466694_235778 | 3300042594 | Bacteria | 1353 |
| 91 | Ga0466735_036586 | 3300042624 | Bacteria | 2270 |
| 92 | Ga0466702_040701 | 3300042635 | Bacteria | 3604 |
| 93 | Ga0466704_007429 | 3300042643 | Bacteria | 5020 |
| 94 | Ga0466709_050086 | 3300042648 | Bacteria | 5430 |
| 95 | Ga0466712_084915 | 3300042614 | Bacteria | 2614 |
| 96 | Ga0466719_167173 | 3300042606 | Bacteria | 32740 |
| 97 | Ga0466722_256921 | 3300042609 | Bacteria | 9980 |
| 98 | Ga0123356_10000810 | 3300010049 | Bacteria | 34730 |
| 99 | JGI24695J34938_10000013 | 3300002450 | Bacteria | 122387 |
| 100 | JGI24695J34938_10000297 | 3300002450 | Bacteria | 49030 |
| 101 | Ga0466692_080331 | 3300042591 | Unclassified | 4324 |
| 102 | Ga0466695_107527 | 3300042595 | Bacteria | 7154 |
| 103 | Ga0466702_160223 | 3300042635 | Bacteria | 16616 |
| 104 | Ga0466703_030185 | 3300042636 | Bacteria | 2434 |
| 105 | Ga0466709_098425 | 3300042648 | Bacteria | 30883 |
| 106 | Ga0466708_091345 | 3300042652 | Bacteria | 69103 |
| 107 | Ga0466708_110918 | 3300042652 | Bacteria | 4880 |
| 108 | Ga0466711_038610 | 3300042615 | Bacteria | 6823 |
| 109 | Ga0466718_019811 | 3300042617 | Bacteria | 2390 |
| 110 | Ga0466723_009928 | 3300042618 | Bacteria | 4532 |
| 111 | Ga0466723_200332 | 3300042618 | Bacteria | 6990 |
| 112 | Ga0466723_233927 | 3300042618 | Bacteria | 1292 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13277 | YmdB | YmdB-like protein | 27 | 296 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.