Protein Family IF07908
Metagenome
Isolate
136
Members
29
Samples
131
Scaffolds
288.62
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_057707|Ga0466718_057707_1361_2386
- Length
- 341 aa
- Sequence
- MRKFHDKLTDKNPTPHSPFPIPHSLPYPPFISKKKIKTIFKFSSNLCYSITKENKMKKICFMGLIFYAIAVNGYAGESDGIYTMKVGQYEVYVLVESERDGNTGILVEADEEVLKLYIPEEGFKHTANAVLIKTPKQNILIDTGTGAGGIIIEKITKLGVQPENIDAVLLTHLHGDHFGSLQKDGAAVFTKAKIYLSAKELEYFTKTNVNQGAADALAPYGSKVTTFQPGELGKKLKAILPGISPIAAYGHTPGHTIFLIENGKNKLLIVGDLLHIALVQFPVPEISATYDMDQKAAAVVRRQVLDYAAKNKIAIAGMHIVYPGTGSVSVEGSGFKFSPSE
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
85.2%
Unclassified
14.8%
Taxonomy
Archaea
2
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 15 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 16 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 22 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_114143 | 3300042656 | Bacteria | 3878 |
| 2 | Ga0466712_069511 | 3300042614 | Unclassified | 2956 |
| 3 | Ga0466712_118350 | 3300042614 | Bacteria | 2470 |
| 4 | Ga0466712_143501 | 3300042614 | Bacteria | 35439 |
| 5 | Ga0466712_242856 | 3300042614 | Bacteria | 10916 |
| 6 | Ga0466718_090029 | 3300042617 | Bacteria | 9794 |
| 7 | Ga0466720_035406 | 3300042607 | Bacteria | 6399 |
| 8 | Ga0466721_382212 | 3300042608 | Bacteria | 1666 |
| 9 | JGI24698J34947_10009327 | 3300002449 | Bacteria | 5387 |
| 10 | JGI24698J34947_10053444 | 3300002449 | Bacteria | 2021 |
| 11 | JGI24698J34947_10083470 | 3300002449 | Bacteria | 1491 |
| 12 | Ga0072941_1057900 | 3300005201 | Bacteria | 3494 |
| 13 | Ga0123356_10027034 | 3300010049 | Bacteria | 5379 |
| 14 | Ga0466712_007685 | 3300042614 | Bacteria | 25961 |
| 15 | Ga0466718_064957 | 3300042617 | Bacteria | 8528 |
| 16 | Ga0466718_068923 | 3300042617 | Bacteria | 5984 |
| 17 | Ga0466718_158419 | 3300042617 | Bacteria | 2254 |
| 18 | Ga0466720_091033 | 3300042607 | Bacteria | 3967 |
| 19 | Ga0466720_135332 | 3300042607 | Bacteria | 3494 |
| 20 | JGI24698J34947_10004198 | 3300002449 | Bacteria | 7832 |
| 21 | JGI24698J34947_10018453 | 3300002449 | Bacteria | 3768 |
| 22 | Ga0466702_245165 | 3300042635 | Bacteria | 4287 |
| 23 | Ga0264413_107400 | 3300024493 | Bacteria | 71506 |
| 24 | Ga0264413_118613 | 3300024493 | Bacteria | 3364 |
| 25 | Ga0466694_040334 | 3300042594 | Bacteria | 9629 |
| 26 | Ga0466694_173232 | 3300042594 | Bacteria | 3226 |
| 27 | Ga0123356_10003815 | 3300010049 | Bacteria | 15694 |
| 28 | Ga0123356_10643100 | 3300010049 | Bacteria | 1227 |
| 29 | Ga0123353_10262604 | 3300010167 | Bacteria | 2665 |
| 30 | Ga0466732_135075 | 3300042656 | Bacteria | 1992 |
| 31 | Ga0466712_073002 | 3300042614 | Bacteria | 5847 |
| 32 | Ga0466712_100741 | 3300042614 | Bacteria | 11811 |
| 33 | Ga0466712_132007 | 3300042614 | Unclassified | 1161 |
| 34 | Ga0466712_293154 | 3300042614 | Bacteria | 18439 |
| 35 | Ga0466718_107595 | 3300042617 | Bacteria | 1880 |
| 36 | Ga0466700_435411 | 3300042600 | Bacteria | 2475 |
| 37 | Ga0466720_037006 | 3300042607 | Bacteria | 11936 |
| 38 | AustNasuHG_c1000405 | 3300000089 | Bacteria | 15002 |
| 39 | Ga0072940_1010814 | 3300005200 | Bacteria | 1170 |
| 40 | Ga0072940_1014643 | 3300005200 | Unclassified | 2348 |
| 41 | Ga0072941_1015202 | 3300005201 | Bacteria | 14533 |
| 42 | Ga0072941_1018335 | 3300005201 | Bacteria | 20323 |
| 43 | Ga0072941_1026918 | 3300005201 | Bacteria | 3634 |
| 44 | Ga0072941_1186064 | 3300005201 | Bacteria | 2102 |
| 45 | Ga0466731_214035 | 3300042622 | Bacteria | 1425 |
| 46 | Ga0466702_252280 | 3300042635 | Bacteria | 3009 |
| 47 | Ga0466699_050168 | 3300042597 | Bacteria | 6542 |
| 48 | Ga0123356_10559958 | 3300010049 | Bacteria | 1305 |
| 49 | Ga0123353_10916865 | 3300010167 | Bacteria | 1190 |
| 50 | Ga0466732_375466 | 3300042656 | Archaea | 4226 |
| 51 | Ga0466718_029053 | 3300042617 | Bacteria | 25767 |
| 52 | Ga0466718_036804 | 3300042617 | Bacteria | 9354 |
| 53 | Ga0466718_116766 | 3300042617 | Bacteria | 4230 |
| 54 | AustNasuHG_c1020979 | 3300000089 | Unclassified | 2120 |
| 55 | JGI24698J34947_10058046 | 3300002449 | Bacteria | 1918 |
| 56 | JGI24698J34947_10066808 | 3300002449 | Bacteria | 1748 |
| 57 | JGI24699J35502_11106963 | 3300002509 | Unclassified | 2544 |
| 58 | Ga0072941_1010092 | 3300005201 | Bacteria | 10814 |
| 59 | Ga0466731_125897 | 3300042622 | Bacteria | 1620 |
| 60 | Ga0264413_109608 | 3300024493 | Bacteria | 2887 |
| 61 | Ga0466694_194652 | 3300042594 | Bacteria | 1672 |
| 62 | Ga0123356_10007613 | 3300010049 | Bacteria | 10796 |
| 63 | Ga0123356_10047047 | 3300010049 | Bacteria | 4014 |
| 64 | Ga0466712_268860 | 3300042614 | Bacteria | 1945 |
| 65 | Ga0466718_004338 | 3300042617 | Bacteria | 5782 |
| 66 | Ga0466718_021841 | 3300042617 | Unclassified | 1465 |
| 67 | Ga0466718_033043 | 3300042617 | Bacteria | 45100 |
| 68 | Ga0466718_079127 | 3300042617 | Bacteria | 6669 |
| 69 | Ga0466718_154198 | 3300042617 | Bacteria | 4911 |
| 70 | 2230954232 | 2228664003 | Bacteria | 8597 |
| 71 | AustNasuHG_c1007280 | 3300000089 | Bacteria | 3941 |
| 72 | JGI24698J34947_10049282 | 3300002449 | Bacteria | 2129 |
| 73 | JGI24698J34947_10105462 | 3300002449 | Bacteria | 1256 |
| 74 | Ga0466731_001498 | 3300042622 | Bacteria | 3412 |
| 75 | Ga0264413_100891 | 3300024493 | Bacteria | 10411 |
| 76 | Ga0264413_101405 | 3300024493 | Bacteria | 19516 |
| 77 | Ga0466693_081613 | 3300042592 | Bacteria | 56251 |
| 78 | Ga0123356_10107049 | 3300010049 | Bacteria | 2693 |
| 79 | Ga0123356_10284816 | 3300010049 | Unclassified | 1750 |
| 80 | Ga0466732_144733 | 3300042656 | Bacteria | 2078 |
| 81 | Ga0466712_048982 | 3300042614 | Unclassified | 1343 |
| 82 | Ga0466712_096231 | 3300042614 | Bacteria | 1472 |
| 83 | Ga0466712_112004 | 3300042614 | Bacteria | 30586 |
| 84 | Ga0466712_199816 | 3300042614 | Bacteria | 2664 |
| 85 | Ga0466718_057707 | 3300042617 | Bacteria | 6861 |
| 86 | Ga0466698_205534 | 3300042610 | Bacteria | 27202 |
| 87 | AustNasuHG_c1010883 | 3300000089 | Unclassified | 3159 |
| 88 | JGI24698J34947_10007975 | 3300002449 | Bacteria | 5813 |
| 89 | Ga0074263_112329 | 3300005485 | Bacteria | 4250 |
| 90 | Ga0466695_128620 | 3300042595 | Bacteria | 2645 |
| 91 | Ga0466699_168840 | 3300042597 | Bacteria | 4206 |
| 92 | Ga0123356_10465202 | 3300010049 | Bacteria | 1415 |
| 93 | Ga0466712_049038 | 3300042614 | Bacteria | 15357 |
| 94 | Ga0466712_137161 | 3300042614 | Bacteria | 2216 |
| 95 | Ga0466712_158809 | 3300042614 | Unclassified | 1139 |
| 96 | Ga0466712_176768 | 3300042614 | Bacteria | 6133 |
| 97 | Ga0466712_259559 | 3300042614 | Bacteria | 8574 |
| 98 | Ga0466720_201936 | 3300042607 | Bacteria | 8150 |
| 99 | JGI24698J34947_10000092 | 3300002449 | Bacteria | 30066 |
| 100 | JGI24698J34947_10000803 | 3300002449 | Bacteria | 15601 |
| 101 | JGI24698J34947_10048329 | 3300002449 | Bacteria | 2155 |
| 102 | JGI24698J34947_10082123 | 3300002449 | Bacteria | 1508 |
| 103 | JGI24695J34938_10021518 | 3300002450 | Bacteria | 3152 |
| 104 | Ga0072941_1009325 | 3300005201 | Bacteria | 25187 |
| 105 | Ga0466702_179170 | 3300042635 | Bacteria | 2382 |
| 106 | Ga0466702_375150 | 3300042635 | Bacteria | 2170 |
| 107 | Ga0264413_100894 | 3300024493 | Bacteria | 5653 |
| 108 | Ga0466695_240548 | 3300042595 | Bacteria | 6263 |
| 109 | Ga0123356_10018271 | 3300010049 | Bacteria | 6659 |
| 110 | Ga0123356_10321534 | 3300010049 | Bacteria | 1660 |
| 111 | Ga0123356_10907320 | 3300010049 | Bacteria | 1052 |
| 112 | Ga0466732_015118 | 3300042656 | Bacteria | 10235 |
| 113 | Ga0466712_151273 | 3300042614 | Bacteria | 2443 |
| 114 | Ga0466712_153586 | 3300042614 | Bacteria | 2749 |
| 115 | Ga0466712_247893 | 3300042614 | Unclassified | 3381 |
| 116 | Ga0466718_021200 | 3300042617 | Bacteria | 1769 |
| 117 | Ga0466720_235388 | 3300042607 | Bacteria | 6009 |
| 118 | AustNasuHG_c1004189 | 3300000089 | Bacteria | 5180 |
| 119 | AustNasuHG_c1007332 | 3300000089 | Unclassified | 3928 |
| 120 | AustNasuHG_c1018911 | 3300000089 | Bacteria | 2267 |
| 121 | JGI24698J34947_10006786 | 3300002449 | Unclassified | 6290 |
| 122 | JGI24702J35022_10008944 | 3300002462 | Bacteria | 5645 |
| 123 | Ga0072940_1126790 | 3300005200 | Bacteria | 1483 |
| 124 | Ga0072941_1038804 | 3300005201 | Bacteria | 1764 |
| 125 | Ga0466731_155404 | 3300042622 | Bacteria | 1580 |
| 126 | Ga0466731_242467 | 3300042622 | Archaea | 1862 |
| 127 | Ga0466731_246641 | 3300042622 | Unclassified | 1191 |
| 128 | Ga0264413_100893 | 3300024493 | Bacteria | 2686 |
| 129 | Ga0466694_096068 | 3300042594 | Bacteria | 20717 |
| 130 | Ga0466699_020786 | 3300042597 | Bacteria | 6530 |
| 131 | Ga0466699_368298 | 3300042597 | Bacteria | 1551 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.