Protein Family IF07907
Metagenome
Isolate
241
Members
52
Samples
232
Scaffolds
217.52
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_056014|Ga0466718_056014_2431_3168
- Length
- 245 aa
- Sequence
- MKVYYLPVKCAAILFDMDSTLYTNPEYARSQIDLPIEKLACMRGLSFNQMNDEITRYRAGWAKEHNGQGISLGNIFKAFGIGIGESVKWREGLYQPEQYLSKDTELRSALEQLKSRFALSVVTNNPVSIAERTLRVLGVEDLFRTRTVVRIVGLDTCGVSKPHEEPFIQAAALCAAPPKSCVSVGDRYDIDIALPLELGMGGILVNGVEDVYNLPEVLIQRASKDTEQVSGRSLYEDGSLCRSVS
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.0%
Kalotermitidae
24.0%
Unclassified
18.0%
Rhinotermitidae
8.0%
Termopsidae
6.0%
Blaberidae
2.0%
Taxonomy
Archaea
2
Bacteria
225
Eukaryota
0
Viruses
1
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 3 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 25 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 26 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 27 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_363447 | 3300042656 | Bacteria | 3060 |
| 2 | Ga0466722_119780 | 3300042609 | Bacteria | 1666 |
| 3 | Ga0466722_163891 | 3300042609 | Bacteria | 2758 |
| 4 | Ga0466712_011461 | 3300042614 | Bacteria | 1428 |
| 5 | Ga0466712_012356 | 3300042614 | Unclassified | 2904 |
| 6 | Ga0466712_023991 | 3300042614 | Bacteria | 1575 |
| 7 | Ga0466712_058311 | 3300042614 | Bacteria | 9364 |
| 8 | Ga0466712_115146 | 3300042614 | Bacteria | 5492 |
| 9 | Ga0466711_005206 | 3300042615 | Bacteria | 3767 |
| 10 | Ga0466718_021014 | 3300042617 | Bacteria | 7039 |
| 11 | Ga0466718_097390 | 3300042617 | Bacteria | 14759 |
| 12 | Ga0466718_157967 | 3300042617 | Bacteria | 3797 |
| 13 | Ga0466723_060388 | 3300042618 | Bacteria | 6422 |
| 14 | Ga0466723_125583 | 3300042618 | Bacteria | 8396 |
| 15 | Ga0466729_048182 | 3300042621 | Archaea | 1022 |
| 16 | Ga0466735_086656 | 3300042624 | Bacteria | 2654 |
| 17 | Ga0466702_321182 | 3300042635 | Bacteria | 3601 |
| 18 | Ga0466703_165679 | 3300042636 | Bacteria | 6836 |
| 19 | Ga0466727_104244 | 3300042655 | Bacteria | 2524 |
| 20 | 2230954376 | 2228664003 | Bacteria | 2476 |
| 21 | JGI24698J34947_10002367 | 3300002449 | Bacteria | 10147 |
| 22 | JGI24698J34947_10004233 | 3300002449 | Bacteria | 7802 |
| 23 | JGI24698J34947_10036694 | 3300002449 | Bacteria | 2551 |
| 24 | JGI24698J34947_10049407 | 3300002449 | Bacteria | 2126 |
| 25 | JGI24698J34947_10117891 | 3300002449 | Bacteria | 1158 |
| 26 | JGI24698J34947_10137368 | 3300002449 | Bacteria | 1035 |
| 27 | JGI24698J34947_10146285 | 3300002449 | Bacteria | 988 |
| 28 | Ga0072941_1020193 | 3300005201 | Bacteria | 12593 |
| 29 | Ga0072941_1067123 | 3300005201 | Viruses | 4910 |
| 30 | Ga0466690_293884 | 3300042590 | Bacteria | 23409 |
| 31 | Ga0466692_037871 | 3300042591 | Bacteria | 14702 |
| 32 | Ga0466692_164232 | 3300042591 | Bacteria | 3819 |
| 33 | Ga0466699_079843 | 3300042597 | Bacteria | 3066 |
| 34 | Ga0466699_164049 | 3300042597 | Bacteria | 2226 |
| 35 | Ga0466699_180216 | 3300042597 | Bacteria | 1868 |
| 36 | Ga0466699_277357 | 3300042597 | Bacteria | 8805 |
| 37 | Ga0466699_347082 | 3300042597 | Unclassified | 6887 |
| 38 | Ga0466732_115789 | 3300042656 | Bacteria | 2827 |
| 39 | Ga0466698_242244 | 3300042610 | Bacteria | 2550 |
| 40 | Ga0123356_10176084 | 3300010049 | Bacteria | 2155 |
| 41 | Ga0466712_094130 | 3300042614 | Bacteria | 1191 |
| 42 | Ga0466712_113274 | 3300042614 | Bacteria | 25758 |
| 43 | Ga0466712_127242 | 3300042614 | Bacteria | 11792 |
| 44 | Ga0466712_128087 | 3300042614 | Bacteria | 1479 |
| 45 | Ga0466712_270139 | 3300042614 | Bacteria | 9907 |
| 46 | Ga0466718_072620 | 3300042617 | Bacteria | 5773 |
| 47 | Ga0466727_172580 | 3300042655 | Bacteria | 2630 |
| 48 | JGI24698J34947_10001213 | 3300002449 | Unclassified | 13495 |
| 49 | JGI24698J34947_10006221 | 3300002449 | Bacteria | 6558 |
| 50 | JGI24698J34947_10029773 | 3300002449 | Bacteria | 2883 |
| 51 | JGI24698J34947_10047977 | 3300002449 | Bacteria | 2165 |
| 52 | JGI24698J34947_10065831 | 3300002449 | Bacteria | 1765 |
| 53 | JGI24698J34947_10068566 | 3300002449 | Bacteria | 1715 |
| 54 | JGI24698J34947_10119651 | 3300002449 | Bacteria | 1146 |
| 55 | JGI24698J34947_10209683 | 3300002449 | Bacteria | 756 |
| 56 | JGI24695J34938_10159186 | 3300002450 | Bacteria | 928 |
| 57 | JGI24702J35022_10014558 | 3300002462 | Bacteria | 4339 |
| 58 | Ga0072940_1001375 | 3300005200 | Bacteria | 3306 |
| 59 | Ga0072941_1001720 | 3300005201 | Bacteria | 26022 |
| 60 | Ga0072941_1003389 | 3300005201 | Bacteria | 37835 |
| 61 | Ga0072941_1162126 | 3300005201 | Bacteria | 1901 |
| 62 | Ga0072941_1189301 | 3300005201 | Bacteria | 999 |
| 63 | Ga0072941_1205205 | 3300005201 | Bacteria | 2036 |
| 64 | Ga0415639_009708 | 3300038395 | Bacteria | 17162 |
| 65 | Ga0466694_130890 | 3300042594 | Bacteria | 1170 |
| 66 | Ga0466699_063670 | 3300042597 | Bacteria | 1746 |
| 67 | Ga0466699_134662 | 3300042597 | Bacteria | 7108 |
| 68 | Ga0466699_335027 | 3300042597 | Bacteria | 1626 |
| 69 | Ga0466707_165224 | 3300042601 | Bacteria | 1804 |
| 70 | Ga0466719_302757 | 3300042606 | Bacteria | 2000 |
| 71 | Ga0466720_144118 | 3300042607 | Bacteria | 25436 |
| 72 | Ga0466722_061348 | 3300042609 | Bacteria | 28035 |
| 73 | Ga0466722_220813 | 3300042609 | Bacteria | 6992 |
| 74 | Ga0466712_002059 | 3300042614 | Bacteria | 10720 |
| 75 | Ga0466712_017684 | 3300042614 | Bacteria | 2172 |
| 76 | Ga0466712_055787 | 3300042614 | Bacteria | 25522 |
| 77 | Ga0466711_355609 | 3300042615 | Bacteria | 6099 |
| 78 | Ga0466723_254512 | 3300042618 | Bacteria | 15504 |
| 79 | Ga0466703_278021 | 3300042636 | Bacteria | 19324 |
| 80 | Ga0466709_249445 | 3300042648 | Bacteria | 6094 |
| 81 | JGI24698J34947_10059066 | 3300002449 | Bacteria | 1897 |
| 82 | JGI24698J34947_10089722 | 3300002449 | Bacteria | 1414 |
| 83 | JGI24698J34947_10097314 | 3300002449 | Bacteria | 1333 |
| 84 | Ga0072941_1031267 | 3300005201 | Bacteria | 7420 |
| 85 | Ga0072941_1116721 | 3300005201 | Bacteria | 1611 |
| 86 | Ga0072941_1187775 | 3300005201 | Bacteria | 1119 |
| 87 | Ga0264413_150615 | 3300024493 | Unclassified | 1467 |
| 88 | Ga0466692_061964 | 3300042591 | Bacteria | 5900 |
| 89 | Ga0466694_021104 | 3300042594 | Bacteria | 19886 |
| 90 | Ga0466699_136625 | 3300042597 | Bacteria | 7726 |
| 91 | Ga0466699_215395 | 3300042597 | Bacteria | 15587 |
| 92 | Ga0466699_215489 | 3300042597 | Bacteria | 5826 |
| 93 | Ga0466732_137723 | 3300042656 | Bacteria | 1220 |
| 94 | Ga0466700_130836 | 3300042600 | Bacteria | 5762 |
| 95 | Ga0466700_271242 | 3300042600 | Bacteria | 1031 |
| 96 | Ga0466722_022418 | 3300042609 | Bacteria | 1815 |
| 97 | Ga0466722_025586 | 3300042609 | Bacteria | 42977 |
| 98 | Ga0466722_053013 | 3300042609 | Bacteria | 5953 |
| 99 | Ga0466712_033294 | 3300042614 | Bacteria | 2317 |
| 100 | Ga0466712_147542 | 3300042614 | Bacteria | 1508 |
| 101 | Ga0466712_151936 | 3300042614 | Unclassified | 2290 |
| 102 | Ga0466712_218817 | 3300042614 | Bacteria | 15145 |
| 103 | Ga0466712_222866 | 3300042614 | Bacteria | 4522 |
| 104 | Ga0466709_146685 | 3300042648 | Bacteria | 3761 |
| 105 | Ga0466708_048892 | 3300042652 | Bacteria | 8746 |
| 106 | JGI24698J34947_10008169 | 3300002449 | Bacteria | 5740 |
| 107 | JGI24698J34947_10012687 | 3300002449 | Bacteria | 4614 |
| 108 | JGI24698J34947_10034708 | 3300002449 | Bacteria | 2637 |
| 109 | JGI24698J34947_10054260 | 3300002449 | Bacteria | 2002 |
| 110 | JGI24698J34947_10067563 | 3300002449 | Bacteria | 1734 |
| 111 | JGI24698J34947_10081442 | 3300002449 | Bacteria | 1517 |
| 112 | JGI24698J34947_10084915 | 3300002449 | Bacteria | 1472 |
| 113 | JGI24698J34947_10119387 | 3300002449 | Unclassified | 1147 |
| 114 | JGI24698J34947_10146539 | 3300002449 | Unclassified | 986 |
| 115 | JGI24698J34947_10167943 | 3300002449 | Bacteria | 891 |
| 116 | JGI24695J34938_10000112 | 3300002450 | Bacteria | 72784 |
| 117 | JGI24695J34938_10141966 | 3300002450 | Bacteria | 981 |
| 118 | Ga0466699_049375 | 3300042597 | Bacteria | 2581 |
| 119 | Ga0466699_178179 | 3300042597 | Bacteria | 2510 |
| 120 | Ga0466699_186450 | 3300042597 | Bacteria | 2181 |
| 121 | Ga0466699_410265 | 3300042597 | Bacteria | 1878 |
| 122 | Ga0466722_225624 | 3300042609 | Bacteria | 24515 |
| 123 | Ga0466712_057732 | 3300042614 | Bacteria | 25744 |
| 124 | Ga0466711_225561 | 3300042615 | Bacteria | 6351 |
| 125 | Ga0466711_297018 | 3300042615 | Bacteria | 6417 |
| 126 | Ga0466718_024619 | 3300042617 | Bacteria | 4056 |
| 127 | Ga0466718_128863 | 3300042617 | Bacteria | 4462 |
| 128 | Ga0466726_224162 | 3300042619 | Bacteria | 1070 |
| 129 | Ga0466729_307575 | 3300042621 | Bacteria | 1602 |
| 130 | Ga0466702_268401 | 3300042635 | Bacteria | 1146 |
| 131 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 132 | Ga0466727_262069 | 3300042655 | Bacteria | 2049 |
| 133 | Ga0466727_310115 | 3300042655 | Bacteria | 1314 |
| 134 | JGI24698J34947_10099399 | 3300002449 | Unclassified | 1312 |
| 135 | JGI24698J34947_10104086 | 3300002449 | Bacteria | 1268 |
| 136 | JGI24698J34947_10132877 | 3300002449 | Unclassified | 1060 |
| 137 | JGI24695J34938_10005366 | 3300002450 | Bacteria | 8011 |
| 138 | Ga0072940_1001374 | 3300005200 | Bacteria | 4910 |
| 139 | Ga0072941_1003204 | 3300005201 | Bacteria | 28763 |
| 140 | Ga0072941_1017503 | 3300005201 | Bacteria | 7379 |
| 141 | Ga0072941_1046080 | 3300005201 | Bacteria | 10767 |
| 142 | Ga0072941_1046258 | 3300005201 | Bacteria | 5575 |
| 143 | Ga0072941_1260265 | 3300005201 | Bacteria | 1034 |
| 144 | Ga0466692_192906 | 3300042591 | Bacteria | 6009 |
| 145 | Ga0466694_242268 | 3300042594 | Bacteria | 3557 |
| 146 | Ga0466694_243307 | 3300042594 | Bacteria | 2546 |
| 147 | Ga0466699_028517 | 3300042597 | Bacteria | 3923 |
| 148 | Ga0466705_121192 | 3300042612 | Bacteria | 3696 |
| 149 | Ga0466717_062077 | 3300042604 | Bacteria | 1109 |
| 150 | Ga0466720_031913 | 3300042607 | Bacteria | 26039 |
| 151 | Ga0466720_083374 | 3300042607 | Bacteria | 17357 |
| 152 | Ga0466720_147686 | 3300042607 | Bacteria | 11788 |
| 153 | Ga0466720_167876 | 3300042607 | Bacteria | 6291 |
| 154 | Ga0466698_231560 | 3300042610 | Bacteria | 4007 |
| 155 | Ga0466712_043625 | 3300042614 | Bacteria | 22329 |
| 156 | Ga0466712_116741 | 3300042614 | Unclassified | 1668 |
| 157 | Ga0466712_139259 | 3300042614 | Bacteria | 21483 |
| 158 | Ga0466711_201079 | 3300042615 | Bacteria | 18389 |
| 159 | Ga0466723_249694 | 3300042618 | Bacteria | 1881 |
| 160 | Ga0466702_250280 | 3300042635 | Bacteria | 23290 |
| 161 | Ga0466703_003504 | 3300042636 | Bacteria | 8799 |
| 162 | JGI24698J34947_10005658 | 3300002449 | Bacteria | 6852 |
| 163 | JGI24698J34947_10013372 | 3300002449 | Unclassified | 4482 |
| 164 | JGI24698J34947_10026416 | 3300002449 | Bacteria | 3085 |
| 165 | JGI24698J34947_10031403 | 3300002449 | Bacteria | 2796 |
| 166 | JGI24698J34947_10034823 | 3300002449 | Bacteria | 2632 |
| 167 | JGI24698J34947_10059666 | 3300002449 | Bacteria | 1885 |
| 168 | JGI24698J34947_10135958 | 3300002449 | Unclassified | 1043 |
| 169 | JGI24695J34938_10000300 | 3300002450 | Bacteria | 48880 |
| 170 | JGI24695J34938_10011230 | 3300002450 | Bacteria | 4838 |
| 171 | Ga0072941_1004367 | 3300005201 | Bacteria | 32939 |
| 172 | Ga0456237_0010419 | 3300041968 | Bacteria | 1372 |
| 173 | Ga0466691_022131 | 3300042593 | Bacteria | 16738 |
| 174 | Ga0466694_048517 | 3300042594 | Bacteria | 1509 |
| 175 | Ga0466694_048947 | 3300042594 | Bacteria | 1377 |
| 176 | Ga0466694_293253 | 3300042594 | Bacteria | 1662 |
| 177 | Ga0466699_012094 | 3300042597 | Bacteria | 1573 |
| 178 | Ga0466717_074796 | 3300042604 | Bacteria | 1310 |
| 179 | Ga0466722_096585 | 3300042609 | Bacteria | 3906 |
| 180 | Ga0466712_011784 | 3300042614 | Bacteria | 50228 |
| 181 | Ga0466712_016310 | 3300042614 | Bacteria | 2768 |
| 182 | Ga0466711_515735 | 3300042615 | Bacteria | 1853 |
| 183 | Ga0466718_056014 | 3300042617 | Bacteria | 7638 |
| 184 | Ga0466723_188935 | 3300042618 | Bacteria | 14921 |
| 185 | Ga0466735_013651 | 3300042624 | Bacteria | 4192 |
| 186 | Ga0466704_314295 | 3300042643 | Bacteria | 4014 |
| 187 | JGI24698J34947_10014138 | 3300002449 | Bacteria | 4348 |
| 188 | JGI24700J35501_10927669 | 3300002508 | Bacteria | 6976 |
| 189 | Ga0072941_1001622 | 3300005201 | Bacteria | 35381 |
| 190 | Ga0072941_1003629 | 3300005201 | Bacteria | 49512 |
| 191 | Ga0072941_1024535 | 3300005201 | Bacteria | 2929 |
| 192 | Ga0072941_1048984 | 3300005201 | Bacteria | 3144 |
| 193 | Ga0415639_242479 | 3300038395 | Unclassified | 2221 |
| 194 | Ga0466692_102530 | 3300042591 | Bacteria | 9798 |
| 195 | Ga0466695_181682 | 3300042595 | Bacteria | 45915 |
| 196 | Ga0466699_000268 | 3300042597 | Bacteria | 3482 |
| 197 | Ga0466699_101383 | 3300042597 | Bacteria | 14098 |
| 198 | Ga0466699_112758 | 3300042597 | Bacteria | 2011 |
| 199 | Ga0466699_148119 | 3300042597 | Bacteria | 7095 |
| 200 | Ga0466699_148491 | 3300042597 | Bacteria | 8331 |
| 201 | Ga0466699_222629 | 3300042597 | Bacteria | 2751 |
| 202 | Ga0466732_347649 | 3300042656 | Bacteria | 3894 |
| 203 | Ga0466717_234045 | 3300042604 | Bacteria | 1970 |
| 204 | Ga0466720_132921 | 3300042607 | Bacteria | 4794 |
| 205 | Ga0466722_115022 | 3300042609 | Bacteria | 7889 |
| 206 | Ga0123353_10084042 | 3300010167 | Bacteria | 5124 |
| 207 | Ga0466712_030681 | 3300042614 | Bacteria | 58628 |
| 208 | Ga0466712_194252 | 3300042614 | Bacteria | 20329 |
| 209 | Ga0466712_219688 | 3300042614 | Bacteria | 2133 |
| 210 | Ga0466712_227094 | 3300042614 | Bacteria | 39101 |
| 211 | Ga0466712_308973 | 3300042614 | Bacteria | 1243 |
| 212 | Ga0466715_221568 | 3300042616 | Bacteria | 4625 |
| 213 | Ga0466715_532224 | 3300042616 | Bacteria | 24324 |
| 214 | Ga0466718_016754 | 3300042617 | Bacteria | 5438 |
| 215 | Ga0466728_083262 | 3300042620 | Bacteria | 4984 |
| 216 | Ga0466727_276513 | 3300042655 | Bacteria | 1406 |
| 217 | AustNasuHG_c1000164 | 3300000089 | Bacteria | 21285 |
| 218 | JGI24698J34947_10025397 | 3300002449 | Bacteria | 3154 |
| 219 | JGI24698J34947_10031870 | 3300002449 | Bacteria | 2770 |
| 220 | Ga0072941_1001715 | 3300005201 | Bacteria | 25527 |
| 221 | Ga0072941_1025903 | 3300005201 | Bacteria | 4819 |
| 222 | Ga0466691_087239 | 3300042593 | Bacteria | 2704 |
| 223 | Ga0466694_330301 | 3300042594 | Bacteria | 1042 |
| 224 | Ga0466699_041834 | 3300042597 | Bacteria | 2198 |
| 225 | Ga0466699_045651 | 3300042597 | Bacteria | 1228 |
| 226 | Ga0466699_112717 | 3300042597 | Bacteria | 3046 |
| 227 | Ga0466699_126315 | 3300042597 | Bacteria | 3104 |
| 228 | Ga0466699_133396 | 3300042597 | Bacteria | 1854 |
| 229 | Ga0466699_143925 | 3300042597 | Bacteria | 1254 |
| 230 | Ga0466699_193851 | 3300042597 | Bacteria | 17422 |
| 231 | Ga0466699_247096 | 3300042597 | Archaea | 3181 |
| 232 | Ga0466699_422290 | 3300042597 | Bacteria | 2715 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.