Protein Family IF07880
Metagenome
Metatranscriptome
Isolate
133
Members
51
Samples
127
Scaffolds
128.86
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_023050|Ga0466718_023050_101_547
- Length
- 148 aa
- Sequence
- MKLLRDTHMVLWAAAGTLPEDAEKMVMDGDNTLYFSPASIWEIGIKKSFGRSDFKVDPEILRRGLLDTHYQELPITSLHALAVNDLPLIHKDPFDRMLLAQAKAEGIALLTSDSLLREYPGPVIFIMPGVHRHLESLADMRQGQEFVT
Sample Types
Isolate
4.5%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
58.3%
Kalotermitidae
20.8%
Unclassified
14.6%
Rhinotermitidae
4.2%
Largidae
2.1%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 2 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_249138 | 3300042612 | Bacteria | 1008 |
| 2 | Ga0466733_195592 | 3300042659 | Bacteria | 14576 |
| 3 | Ga0466705_432849 | 3300042612 | Bacteria | 1697 |
| 4 | Ga0466712_042892 | 3300042614 | Bacteria | 7136 |
| 5 | Ga0466715_226016 | 3300042616 | Bacteria | 10577 |
| 6 | Ga0466715_306563 | 3300042616 | Bacteria | 1541 |
| 7 | Ga0466718_150638 | 3300042617 | Bacteria | 5435 |
| 8 | Ga0466728_383596 | 3300042620 | Bacteria | 1655 |
| 9 | Ga0123356_10000496 | 3300010049 | Bacteria | 43882 |
| 10 | Ga0123353_10060371 | 3300010167 | Bacteria | 6081 |
| 11 | Ga0123353_12022087 | 3300010167 | Bacteria | 705 |
| 12 | Ga0466720_159954 | 3300042607 | Bacteria | 2076 |
| 13 | Ga0466698_211848 | 3300042610 | Bacteria | 1918 |
| 14 | Ga0466693_235732 | 3300042592 | Bacteria | 1174 |
| 15 | Ga0466695_252997 | 3300042595 | Bacteria | 7979 |
| 16 | Ga0466696_399461 | 3300042596 | Bacteria | 1239 |
| 17 | Ga0466729_301753 | 3300042621 | Bacteria | 11534 |
| 18 | Ga0466730_013546 | 3300042625 | Bacteria | 3619 |
| 19 | Ga0466709_089855 | 3300042648 | Bacteria | 2707 |
| 20 | Ga0466705_479734 | 3300042612 | Bacteria | 1014 |
| 21 | Ga0466711_368577 | 3300042615 | Bacteria | 3699 |
| 22 | Ga0123355_10042596 | 3300009826 | Bacteria | 7390 |
| 23 | Ga0123356_10081871 | 3300010049 | Bacteria | 3055 |
| 24 | Ga0123356_10100976 | 3300010049 | Unclassified | 2767 |
| 25 | Ga0123356_11179325 | 3300010049 | Bacteria | 932 |
| 26 | Ga0123354_10978514 | 3300010882 | Unclassified | 546 |
| 27 | Ga0466707_253335 | 3300042601 | Bacteria | 20552 |
| 28 | Ga0466713_135521 | 3300042602 | Bacteria | 1483 |
| 29 | Ga0264413_116629 | 3300024493 | Bacteria | 1422 |
| 30 | Ga0415639_102788 | 3300038395 | Bacteria | 1593 |
| 31 | Ga0415639_208797 | 3300038395 | Unclassified | 1947 |
| 32 | Ga0466694_362195 | 3300042594 | Bacteria | 2913 |
| 33 | Ga0466699_116561 | 3300042597 | Bacteria | 1769 |
| 34 | Ga0466705_135432 | 3300042612 | Bacteria | 1769 |
| 35 | Ga0466704_096174 | 3300042643 | Bacteria | 4078 |
| 36 | Ga0466704_208630 | 3300042643 | Bacteria | 1218 |
| 37 | Ga0466708_199867 | 3300042652 | Bacteria | 18655 |
| 38 | Ga0123357_10059254 | 3300009784 | Bacteria | 5138 |
| 39 | Ga0123353_10589593 | 3300010167 | Bacteria | 1592 |
| 40 | Ga0123353_10746964 | 3300010167 | Bacteria | 1362 |
| 41 | Ga0466717_151008 | 3300042604 | Bacteria | 16555 |
| 42 | Ga0466722_132378 | 3300042609 | Bacteria | 4258 |
| 43 | Ga0466698_140502 | 3300042610 | Bacteria | 2126 |
| 44 | JGI24698J34947_10115181 | 3300002449 | Unclassified | 1178 |
| 45 | JGI24698J34947_10226611 | 3300002449 | Bacteria | 713 |
| 46 | Ga0466697_099641 | 3300042611 | Bacteria | 1363 |
| 47 | Ga0466732_316918 | 3300042656 | Bacteria | 8246 |
| 48 | Ga0466730_029631 | 3300042625 | Bacteria | 10152 |
| 49 | Ga0466704_254033 | 3300042643 | Bacteria | 1037 |
| 50 | Ga0466704_599935 | 3300042643 | Bacteria | 7108 |
| 51 | Ga0123356_10204642 | 3300010049 | Bacteria | 2017 |
| 52 | Ga0123353_10008133 | 3300010167 | Bacteria | 14284 |
| 53 | Ga0123353_10315736 | 3300010167 | Bacteria | 2375 |
| 54 | Ga0466700_019956 | 3300042600 | Bacteria | 2944 |
| 55 | Ga0466717_245508 | 3300042604 | Bacteria | 2061 |
| 56 | Ga0466717_307096 | 3300042604 | Bacteria | 1436 |
| 57 | Ga0223674_1008157 | 3300021235 | Bacteria | 1526 |
| 58 | Ga0466711_268586 | 3300042615 | Bacteria | 9913 |
| 59 | Ga0466715_520084 | 3300042616 | Bacteria | 8040 |
| 60 | Ga0466718_113835 | 3300042617 | Bacteria | 1309 |
| 61 | Ga0123355_10002335 | 3300009826 | Bacteria | 26805 |
| 62 | Ga0123355_10359985 | 3300009826 | Bacteria | 1917 |
| 63 | Ga0123356_10092162 | 3300010049 | Bacteria | 2889 |
| 64 | Ga0123356_10346636 | 3300010049 | Bacteria | 1608 |
| 65 | Ga0123356_12454772 | 3300010049 | Unclassified | 652 |
| 66 | Ga0466701_033473 | 3300042598 | Bacteria | 6151 |
| 67 | Ga0466707_079192 | 3300042601 | Bacteria | 6947 |
| 68 | Ga0466717_115028 | 3300042604 | Unclassified | 1130 |
| 69 | Ga0466717_300803 | 3300042604 | Bacteria | 1273 |
| 70 | Ga0466721_224537 | 3300042608 | Bacteria | 1479 |
| 71 | Ga0466698_091280 | 3300042610 | Bacteria | 2842 |
| 72 | Ga0415639_009154 | 3300038395 | Bacteria | 2781 |
| 73 | Ga0072940_1543716 | 3300005200 | Bacteria | 673 |
| 74 | Ga0123357_10001441 | 3300009784 | Bacteria | 25238 |
| 75 | Ga0466705_090257 | 3300042612 | Bacteria | 20445 |
| 76 | Ga0466730_046732 | 3300042625 | Unclassified | 1506 |
| 77 | Ga0466703_076215 | 3300042636 | Bacteria | 19311 |
| 78 | Ga0466708_070920 | 3300042652 | Unclassified | 12470 |
| 79 | Ga0466725_336241 | 3300042654 | Bacteria | 1371 |
| 80 | Ga0466705_488117 | 3300042612 | Bacteria | 1015 |
| 81 | Ga0466711_237580 | 3300042615 | Bacteria | 1568 |
| 82 | Ga0466715_175810 | 3300042616 | Unclassified | 1079 |
| 83 | Ga0466715_199711 | 3300042616 | Bacteria | 6221 |
| 84 | Ga0466718_025078 | 3300042617 | Bacteria | 25020 |
| 85 | Ga0123355_10160753 | 3300009826 | Bacteria | 3384 |
| 86 | Ga0123355_11406182 | 3300009826 | Bacteria | 689 |
| 87 | Ga0123353_10061179 | 3300010167 | Bacteria | 6038 |
| 88 | Ga0123353_10182805 | 3300010167 | Bacteria | 3317 |
| 89 | Ga0466719_544184 | 3300042606 | Bacteria | 3711 |
| 90 | Ga0466722_222970 | 3300042609 | Bacteria | 1549 |
| 91 | Ga0466698_054032 | 3300042610 | Bacteria | 1949 |
| 92 | Ga0466698_126898 | 3300042610 | Bacteria | 1759 |
| 93 | JGI24702J35022_10064014 | 3300002462 | Bacteria | 1971 |
| 94 | JGI24702J35022_10456349 | 3300002462 | Unclassified | 779 |
| 95 | JGI24702J35022_10554018 | 3300002462 | Bacteria | 709 |
| 96 | JGI24705J35276_12177792 | 3300002504 | Bacteria | 1342 |
| 97 | Ga0466705_070035 | 3300042612 | Bacteria | 55496 |
| 98 | Ga0466705_253765 | 3300042612 | Bacteria | 1755 |
| 99 | Ga0466704_271639 | 3300042643 | Unclassified | 2860 |
| 100 | Ga0466712_213962 | 3300042614 | Bacteria | 1447 |
| 101 | Ga0466715_248053 | 3300042616 | Bacteria | 3309 |
| 102 | Ga0466718_013494 | 3300042617 | Bacteria | 9781 |
| 103 | Ga0466718_023050 | 3300042617 | Bacteria | 1394 |
| 104 | Ga0123357_10075174 | 3300009784 | Bacteria | 4465 |
| 105 | Ga0123355_10507338 | 3300009826 | Bacteria | 1484 |
| 106 | Ga0123356_10031092 | 3300010049 | Bacteria | 4997 |
| 107 | Ga0123356_10035745 | 3300010049 | Bacteria | 4638 |
| 108 | Ga0123353_10191811 | 3300010167 | Bacteria | 3224 |
| 109 | Ga0123354_10886970 | 3300010882 | Bacteria | 587 |
| 110 | Ga0466720_000660 | 3300042607 | Bacteria | 1515 |
| 111 | Ga0466693_356649 | 3300042592 | Bacteria | 1782 |
| 112 | Ga0466694_071113 | 3300042594 | Unclassified | 1274 |
| 113 | AustNasuHG_c1004846 | 3300000089 | Bacteria | 4817 |
| 114 | JGI24702J35022_10345826 | 3300002462 | Bacteria | 888 |
| 115 | Ga0072941_1222455 | 3300005201 | Bacteria | 875 |
| 116 | Ga0466705_100765 | 3300042612 | Bacteria | 29793 |
| 117 | Ga0466732_154077 | 3300042656 | Bacteria | 2524 |
| 118 | Ga0466703_184660 | 3300042636 | Bacteria | 1978 |
| 119 | Ga0466711_179349 | 3300042615 | Bacteria | 4730 |
| 120 | Ga0466715_414421 | 3300042616 | Bacteria | 2098 |
| 121 | Ga0123355_10000478 | 3300009826 | Bacteria | 53107 |
| 122 | Ga0123355_10055820 | 3300009826 | Bacteria | 6395 |
| 123 | Ga0123354_10429972 | 3300010882 | Unclassified | 1088 |
| 124 | Ga0466721_174989 | 3300042608 | Bacteria | 226195 |
| 125 | Ga0415639_008213 | 3300038395 | Bacteria | 17549 |
| 126 | Ga0415639_010327 | 3300038395 | Bacteria | 14006 |
| 127 | JGI24702J35022_10558977 | 3300002462 | Unclassified | 705 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 6 | 120 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.